ai-crew
Fable 5-orchestrated team-lead workflow with strict 1-level dispatch — plan big, execute small. Vendored on top of agent-skills' 21-skill workflow library. Single human checkpoint…
Plugin-Paket · von goktug · nicht mehr gelistet
Überblick
ai-crew ist ein Plugin-Paket für KI-Coding-Tools von goktug. Kein Marktplatz, den wir lesen, listet es noch; der letzte Eintrag verschwand am 2026-10-21. Die letzte erfasste Änderung war am 2026-10-21. Stand unseres Marktplatz-Durchlaufs vom 2026-10-20.
Fable 5-orchestrated team-lead workflow with strict 1-level dispatch — plan big, execute small. Vendored on top of agent-skills' 21-skill workflow library. Single human checkpoint at plan approval; rest of the lifecycle runs end to end.
Was es abfragt
- Wird als Plugin-Paket installiert
- Deklarierte Hooks: 1
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Verbinden
Keine Daten für einen automatischen Befehl: Die Angaben der Marktplätze sagen nicht eindeutig, wie man es verbindet.
Wo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz goktug/ai-crew (Quelle auf GitHub öffnen) | Entfernt am 2026-10-21 | 0.1.16 | Forks (GitHub): 0 Sterne (GitHub): 6 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
Skills: 24
api-and-interface-designbrowser-testing-with-devtoolsci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringdebugging-and-error-recoverydeprecation-and-migrationdocumentation-and-adrsfrontend-ui-engineeringgit-workflow-and-versioningidea-refine
Weitere anzeigen: 12
incremental-implementationintake-with-validationmobile-component-testing-with-rntlperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmentteam-leadtest-driven-developmentusing-agent-skills
Befehle: 8
buildcode-simplifyplanreviewshipspecteam-leadtest
Agenten: 7
code-reviewerfable-developeropus-developersecurity-auditorsonnet-developertest-engineerweb-researcher
Hooks: 1
SessionStart
Was sich geändert hat
- Nicht mehr auf Community GitHub marketplaces gelistet
- Community GitHub marketplaces: entfernt
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
-
Autonomous Development Orchestrator for Claude Code. Spec → Plan → Tasks → 100% Working App. Multi-agent pipeline with zero manual intervention.
-
Guild turns Claude Code into a self-evolving team of specialist agents for larger software tasks. It plans before execution, selects the right specialists, assembles focused…
-
Vendor-neutral work lanes, skills, and platform exports for coding agents.
-
Structured development skills for any project. Provides brainstorming, planning, parallel agent development, browser testing, systematic debugging, and self-improvement workflows.
-
Agentic Engineering toolkit with 12 structured workflow skills, 5 specialist agent personas, and 7 slash commands. Covers the full development lifecycle from idea to production…
-
Universal multi-agent project harness for Claude Code — run any project through a structured AI team from discovery to release.
-
project-scaffolder-synaptic-edition
Generate a complete project knowledge base from a single brief, then orchestrate development with an AI project leader, quality pipeline, and skills that learn from experience…
-
Advanced debugging, code review, deep research, technical documentation, creative ideation, and semi-autonomous development workflows with parallel theory validation, team-based…
-
CAST — Claude Agent Specialist Team
Multi-agent control plane for Claude Code: curated specialist agents, hook-enforced quality gates, and SQLite observability.
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
Guild turns Claude Code into a self-evolving team of specialist agents for larger software tasks. It plans before execution, selects the right specialists, assembles focused…
-
Agentic Engineering toolkit with 12 structured workflow skills, 5 specialist agent personas, and 7 slash commands. Covers the full development lifecycle from idea to production…
-
Universal multi-agent project harness for Claude Code — run any project through a structured AI team from discovery to release.
-
project-scaffolder-synaptic-edition
Generate a complete project knowledge base from a single brief, then orchestrate development with an AI project leader, quality pipeline, and skills that learn from experience…
-
Advanced debugging, code review, deep research, technical documentation, creative ideation, and semi-autonomous development workflows with parallel theory validation, team-based…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Output.ai workflow development toolkit for Claude Code. Adds 5 specialist agents (planner, builder, debugger, prompt writer, quality reviewer), 40+ slash-command skills covering…
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
Gelistet auf Claude: knowledge-work-plugins (5)
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Keep your coding agent up to date with the latest web best practices
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
Build web apps with frontend asset design, browser testing, UI components, payments, and database guidance.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Build with OpenAI APIs, Agents SDK, and ChatGPT Apps, and create and save OpenAI API keys from Codex.
-
Figma workflows for design implementation, Code Connect templates, and design system rule generation.
Gelistet auf Community GitHub marketplaces (5)
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
-
Autonomous Development Orchestrator for Claude Code. Spec → Plan → Tasks → 100% Working App. Multi-agent pipeline with zero manual intervention.
-
Vendor-neutral work lanes, skills, and platform exports for coding agents.
-
Structured development skills for any project. Provides brainstorming, planning, parallel agent development, browser testing, systematic debugging, and self-improvement workflows.
-
CAST — Claude Agent Specialist Team
Multi-agent control plane for Claude Code: curated specialist agents, hook-enforced quality gates, and SQLite observability.
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Model, visualize, and deploy applications with Radius from the GitHub Copilot app and CLI.
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Advanced Security plugin for GitHub Copilot.
Gelistet auf Cursor: cursor/plugins (5)
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Gelistet auf Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Tools and resources for writing Effect code in Typescript.
-
MCP server for terminal commands, file operations, and process management
Gelistet auf Official MCP Registry (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
Autonomous factory that finds real developer pain points and builds small paid AI tools to fix them.
-
StoriesOnBoard - structured specifications for AI Agents
Turn PRDs and product ideas into structured specs so coding agents build your intent, not theirs.
-
Grow your skills with AI: per-skill coaching inside Claude, ChatGPT, Cursor and Codex
-
fable io.github.codeChap/fable
Anthropic Claude Fable 5 MCP server — top-tier planning and code critique for handoff
Gelistet auf npm registry (MCP servers) (5)
-
One workspace for every AI coding assistant. Shared tasks, memory, and governance.
-
Local persistent memory and Markdown wiki for AI coding agents: 24 MCP tools, no gateway required.
-
Shared project memory for Claude Code, Codex and Cursor: decisions and corrections through MCP.
-
Local coding tools for ChatGPT Developer Mode and MCP clients with safe editing and shell execution.
-
mistral-mcp io.github.Swih/mistral-mcp
Mistral MCP server: extract invoices and documents from text, Markdown or OCR into typed JSON.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.