ai-crew
Fable 5-orchestrated team-lead workflow with strict 1-level dispatch — plan big, execute small. Vendored on top of agent-skills' 21-skill workflow library. Single human checkpoint…
Plugin bundle · by goktug · no longer listed
About
ai-crew is a plugin bundle for AI coding tools published by goktug. No marketplace we read lists it any more; the last listing left on 2026-10-21. The last change we recorded was on 2026-10-21. As of our marketplace pass on 2026-10-20.
Fable 5-orchestrated team-lead workflow with strict 1-level dispatch — plan big, execute small. Vendored on top of agent-skills' 21-skill workflow library. Single human checkpoint at plan approval; rest of the lifecycle runs end to end.
What it asks for
- Installs as a plugin bundle
- Hooks: 1
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Connect
No data for an automatic command: what its marketplaces declare does not say unambiguously how to connect it.
Where it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Community marketplace goktug/ai-crew (Open the source on GitHub) | Removed on 2026-10-21 | 0.1.16 | Forks (GitHub): 0 Stars (GitHub): 6 |
Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
What the bundle contains
As published on Community GitHub marketplaces.
Skills: 24
api-and-interface-designbrowser-testing-with-devtoolsci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringdebugging-and-error-recoverydeprecation-and-migrationdocumentation-and-adrsfrontend-ui-engineeringgit-workflow-and-versioningidea-refine
Show the remaining 12
incremental-implementationintake-with-validationmobile-component-testing-with-rntlperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmentteam-leadtest-driven-developmentusing-agent-skills
Commands: 8
buildcode-simplifyplanreviewshipspecteam-leadtest
Agents: 7
code-reviewerfable-developeropus-developersecurity-auditorsonnet-developertest-engineerweb-researcher
Hooks: 1
SessionStart
What changed
- No longer listed on Community GitHub marketplaces
- Community GitHub marketplaces: removed
- Became a product we track
- Community GitHub marketplaces: appeared
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
-
Autonomous Development Orchestrator for Claude Code. Spec → Plan → Tasks → 100% Working App. Multi-agent pipeline with zero manual intervention.
-
Guild turns Claude Code into a self-evolving team of specialist agents for larger software tasks. It plans before execution, selects the right specialists, assembles focused…
-
Vendor-neutral work lanes, skills, and platform exports for coding agents.
-
Structured development skills for any project. Provides brainstorming, planning, parallel agent development, browser testing, systematic debugging, and self-improvement workflows.
-
Agentic Engineering toolkit with 12 structured workflow skills, 5 specialist agent personas, and 7 slash commands. Covers the full development lifecycle from idea to production…
-
Universal multi-agent project harness for Claude Code — run any project through a structured AI team from discovery to release.
-
project-scaffolder-synaptic-edition
Generate a complete project knowledge base from a single brief, then orchestrate development with an AI project leader, quality pipeline, and skills that learn from experience…
-
Advanced debugging, code review, deep research, technical documentation, creative ideation, and semi-autonomous development workflows with parallel theory validation, team-based…
-
CAST — Claude Agent Specialist Team
Multi-agent control plane for Claude Code: curated specialist agents, hook-enforced quality gates, and SQLite observability.
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
Guild turns Claude Code into a self-evolving team of specialist agents for larger software tasks. It plans before execution, selects the right specialists, assembles focused…
-
Agentic Engineering toolkit with 12 structured workflow skills, 5 specialist agent personas, and 7 slash commands. Covers the full development lifecycle from idea to production…
-
Universal multi-agent project harness for Claude Code — run any project through a structured AI team from discovery to release.
-
project-scaffolder-synaptic-edition
Generate a complete project knowledge base from a single brief, then orchestrate development with an AI project leader, quality pipeline, and skills that learn from experience…
-
Advanced debugging, code review, deep research, technical documentation, creative ideation, and semi-autonomous development workflows with parallel theory validation, team-based…
Has a listing on Claude Code: claude-plugins-official (5)
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Output.ai workflow development toolkit for Claude Code. Adds 5 specialist agents (planner, builder, debugger, prompt writer, quality reviewer), 40+ slash-command skills covering…
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
Has a listing on Claude: knowledge-work-plugins (5)
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Keep your coding agent up to date with the latest web best practices
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
Build web apps with frontend asset design, browser testing, UI components, payments, and database guidance.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Build with OpenAI APIs, Agents SDK, and ChatGPT Apps, and create and save OpenAI API keys from Codex.
-
Figma workflows for design implementation, Code Connect templates, and design system rule generation.
Has a listing on Community GitHub marketplaces (5)
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
-
Autonomous Development Orchestrator for Claude Code. Spec → Plan → Tasks → 100% Working App. Multi-agent pipeline with zero manual intervention.
-
Vendor-neutral work lanes, skills, and platform exports for coding agents.
-
Structured development skills for any project. Provides brainstorming, planning, parallel agent development, browser testing, systematic debugging, and self-improvement workflows.
-
CAST — Claude Agent Specialist Team
Multi-agent control plane for Claude Code: curated specialist agents, hook-enforced quality gates, and SQLite observability.
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Model, visualize, and deploy applications with Radius from the GitHub Copilot app and CLI.
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Advanced Security plugin for GitHub Copilot.
Has a listing on Cursor: cursor/plugins (5)
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Has a listing on Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Tools and resources for writing Effect code in Typescript.
-
MCP server for terminal commands, file operations, and process management
Has a listing on Official MCP Registry (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
Autonomous factory that finds real developer pain points and builds small paid AI tools to fix them.
-
StoriesOnBoard - structured specifications for AI Agents
Turn PRDs and product ideas into structured specs so coding agents build your intent, not theirs.
-
Grow your skills with AI: per-skill coaching inside Claude, ChatGPT, Cursor and Codex
-
fable io.github.codeChap/fable
Anthropic Claude Fable 5 MCP server — top-tier planning and code critique for handoff
Has a listing on npm registry (MCP servers) (5)
-
One workspace for every AI coding assistant. Shared tasks, memory, and governance.
-
Local persistent memory and Markdown wiki for AI coding agents: 24 MCP tools, no gateway required.
-
Shared project memory for Claude Code, Codex and Cursor: decisions, corrections, overlap warnings.
-
Local coding tools for ChatGPT Developer Mode and MCP clients with safe editing and shell execution.
-
mistral-mcp io.github.Swih/mistral-mcp
Mistral MCP server: extract invoices and documents from text, Markdown or OCR into typed JSON.
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Want this mark on your plugin in our catalog?
Prove you maintain it with a file in its repository, a file on your domain or a DNS record, and you can show this mark on the card, with live banners for your site and README. How verification works
You also get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from public marketplace files in GitHub repositories of their authors. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.