aide
AI Development Environment - Multi-agent orchestration for Claude Code
Plugin-Paket · von John Mylchreest
Überblick
aide ist ein Plugin-Paket für KI-Coding-Tools von John Mylchreest. Marktplätze, die wir lesen und die es listen: 1 (Community GitHub marketplaces). Wir haben es erstmals am 2026-10-23 gesehen und seither keine Änderung erfasst. Stand unseres Marktplatz-Durchlaufs vom 2026-10-23.
Was es abfragt
- Wird als Plugin-Paket installiert
- Deklarierte Hooks: 24
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add jmylchreest/aide
/plugin install aide@aideWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz jmylchreest/aide (Quelle auf GitHub öffnen) | Gelistet | 0.1.18 | Keine Zahl veröffentlicht | Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
In einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| aide | jmylchreest/aide | 19 |
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
MCP-Server: 1
aide
Skills: 26
assess-findingsautopilotbuild-fixcode-searchcontext-usagedebugdecidedesigndocsforgetgitimplement
Weitere anzeigen: 14
memorisepatternsperfplan-swarmrecallreflectreviewsemgrepsurveyswarmswarm-statustestverifyworktree-resolve
Hooks: 10
PostToolUsePostToolUseFailurePreCompactPreToolUseSessionEndSessionStartStopSubagentStartSubagentStopUserPromptSubmit
Was sich geändert hat
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Structured workflows, parallel agents, hooks, and skills using Claude Code's native architecture.
-
Superpowers skills + Beads issue tracking for Claude Code, Codex, OpenCode, and 7 more AI coding agents: TDD, debugging, code review, and persistent task memory.
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
Boost your development workflow with AI-powered agents for code review, debugging, and strategic planning.
-
Comprendo gates AI implementation behind a visual developer approval step. When you type /comprendo <task>, Claude reads your codebase, builds a structured plan with before/after…
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
Endor Labs workflow agents and setup for Claude Code.
-
Self-correcting loop engineering and automated codebase research.
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
Comprendo gates AI implementation behind a visual developer approval step. When you type /comprendo <task>, Claude reads your codebase, builds a structured plan with before/after…
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
AgentsAtlas is a minimal, opinionated end-to-end workflow for Claude Code (also available as Codex skills). Eight slash commands take a project from setup through planning…
-
Multi-agent development harness for Claude Code. Your AI has speed; we give it direction — through living specs and focused specialist agents.
Gelistet auf Claude Code: claude-plugins-official (5)
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Gelistet auf Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
MCP server for terminal commands, file operations, and process management
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
AI-powered code review in Codex, powered by CodeRabbit.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Build with OpenAI APIs, Agents SDK, and ChatGPT Apps, and create and save OpenAI API keys from Codex.
-
Qodo setup, code intelligence, and review workflows.
Gelistet auf Community GitHub marketplaces (5)
-
Structured workflows, parallel agents, hooks, and skills using Claude Code's native architecture.
-
Superpowers skills + Beads issue tracking for Claude Code, Codex, OpenCode, and 7 more AI coding agents: TDD, debugging, code review, and persistent task memory.
-
Boost your development workflow with AI-powered agents for code review, debugging, and strategic planning.
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Model, visualize, and deploy applications with Radius from the GitHub Copilot app and CLI.
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Gelistet auf Cursor: cursor/plugins (5)
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Build apps, scripts, and automations with the TypeScript SDK.
Gelistet auf Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
MCP server for terminal commands, file operations, and process management
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Giving Claude ability to run code with E2B via MCP (Model Context Protocol).
Gelistet auf Official MCP Registry (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
Community of Consciousness MCP Server — upload and explore collective wisdom via GitHub.
-
An MCP server that stores Copilot customizations from the Awesome Copilot repository
-
orbit io.github.constellation-works/orbit
Orbit's local-first task and workflow registry for coding agents.
-
Install the ContinueWith AI handoff widget from coding agents (Cursor, Claude Code, Codex).
Gelistet auf PyPI (MCP servers) (5)
-
Let one coding-agent CLI consult another: Codex, Claude Code, OpenCode, Copilot or Antigravity.
-
Zero-config MCP server for searchable documentation. SQLite or PostgreSQL.
-
repo-graph io.github.James-Chahwan/repo-graph
Structural graph map of any codebase so LLMs navigate by structure, not guesswork.
-
lineai-mcp-server io.github.lineai-intelligence/lineai-mcp-server
An MCP Server to utilize Lineai's rich software dependency data in your AI programming assistant.
-
marm-mcp-server io.github.Lyellr88/marm-mcp-server
Universal MCP Server with advanced AI memory capabilities and semantic search.
Gelistet auf npm registry (MCP servers) (5)
-
speclock io.github.sgroy10/speclock
AI Constraint Engine — enforces CLAUDE.md and .cursorrules as laws. 51 MCP tools.
-
One workspace for every AI coding assistant. Shared tasks, memory, and governance.
-
review-assist-mcp io.github.uditk2/review-assist-mcp
Turns an AI coding agent session into a reviewable Intent Document, validated against the diff.
-
mistral-mcp io.github.Swih/mistral-mcp
Mistral MCP server: extract invoices and documents from text, Markdown or OCR into typed JSON.
-
Local coding tools for ChatGPT Developer Mode and MCP clients with safe editing and shell execution.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.