aide
AI Development Environment - Multi-agent orchestration for Claude Code
Plugin bundle · by John Mylchreest
About
aide is a plugin bundle for AI coding tools published by John Mylchreest. Marketplaces we read that list it: 1 (Community GitHub marketplaces). We first saw it on 2026-10-23 and have recorded no change since. As of our marketplace pass on 2026-10-24.
What it asks for
- Installs as a plugin bundle
- Hooks: 24
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Works with
- Claude Code
From the marketplaces that list it and the MCP transport it declares, as each client documents them. We do not test plugins.
Connect
Commands and configs built only from what its marketplaces declare. We do not run them for you and do not test plugins.
As a Claude Code plugin
Built from what Community GitHub marketplaces declares.
/plugin marketplace add jmylchreest/aide
/plugin install aide@aideWhere it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Community marketplace jmylchreest/aide (Open the source on GitHub) | Listed | 0.1.18 | No figure published | Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
Listed in one community marketplace
| Marketplace | Repository | Stars (GitHub) |
|---|---|---|
| aide | jmylchreest/aide | 19 |
What the bundle contains
As published on Community GitHub marketplaces.
MCP servers: 1
aide
Skills: 26
assess-findingsautopilotbuild-fixcode-searchcontext-usagedebugdecidedesigndocsforgetgitimplement
Show the remaining 14
memorisepatternsperfplan-swarmrecallreflectreviewsemgrepsurveyswarmswarm-statustestverifyworktree-resolve
Hooks: 10
PostToolUsePostToolUseFailurePreCompactPreToolUseSessionEndSessionStartStopSubagentStartSubagentStopUserPromptSubmit
What changed
- Became a product we track
- Community GitHub marketplaces: appeared
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
Structured workflows, parallel agents, hooks, and skills using Claude Code's native architecture.
-
Superpowers skills + Beads issue tracking for Claude Code, Codex, OpenCode, and 7 more AI coding agents: TDD, debugging, code review, and persistent task memory.
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
Boost your development workflow with AI-powered agents for code review, debugging, and strategic planning.
-
Comprendo gates AI implementation behind a visual developer approval step. When you type /comprendo <task>, Claude reads your codebase, builds a structured plan with before/after…
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
Endor Labs workflow agents and setup for Claude Code.
-
Self-correcting loop engineering and automated codebase research.
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
Comprendo gates AI implementation behind a visual developer approval step. When you type /comprendo <task>, Claude reads your codebase, builds a structured plan with before/after…
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
AgentsAtlas is a minimal, opinionated end-to-end workflow for Claude Code (also available as Codex skills). Eight slash commands take a project from setup through planning…
-
Multi-agent development harness for Claude Code. Your AI has speed; we give it direction — through living specs and focused specialist agents.
Has a listing on Claude Code: claude-plugins-official (5)
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Has a listing on Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
MCP server for terminal commands, file operations, and process management
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
AI-powered code review in Codex, powered by CodeRabbit.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Build with OpenAI APIs, Agents SDK, and ChatGPT Apps, and create and save OpenAI API keys from Codex.
-
Qodo setup, code intelligence, and review workflows.
Has a listing on Community GitHub marketplaces (5)
-
Structured workflows, parallel agents, hooks, and skills using Claude Code's native architecture.
-
Superpowers skills + Beads issue tracking for Claude Code, Codex, OpenCode, and 7 more AI coding agents: TDD, debugging, code review, and persistent task memory.
-
Boost your development workflow with AI-powered agents for code review, debugging, and strategic planning.
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Feature-centric development framework for Claude Code — brainstorm, plan, build, and verify with structured workflows
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Model, visualize, and deploy applications with Radius from the GitHub Copilot app and CLI.
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Has a listing on Cursor: cursor/plugins (5)
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Build apps, scripts, and automations with the TypeScript SDK.
Has a listing on Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
MCP server for terminal commands, file operations, and process management
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Giving Claude ability to run code with E2B via MCP (Model Context Protocol).
Has a listing on Official MCP Registry (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
Community of Consciousness MCP Server — upload and explore collective wisdom via GitHub.
-
An MCP server that stores Copilot customizations from the Awesome Copilot repository
-
orbit io.github.constellation-works/orbit
Orbit's local-first task and workflow registry for coding agents.
-
Install the ContinueWith AI handoff widget from coding agents (Cursor, Claude Code, Codex).
Has a listing on PyPI (MCP servers) (5)
-
Let one coding-agent CLI consult another: Codex, Claude Code, OpenCode, Copilot or Antigravity.
-
Zero-config MCP server for searchable documentation. SQLite or PostgreSQL.
-
repo-graph io.github.James-Chahwan/repo-graph
Structural graph map of any codebase so LLMs navigate by structure, not guesswork.
-
lineai-mcp-server io.github.lineai-intelligence/lineai-mcp-server
An MCP Server to utilize Lineai's rich software dependency data in your AI programming assistant.
-
marm-mcp-server io.github.Lyellr88/marm-mcp-server
Universal MCP Server with advanced AI memory capabilities and semantic search.
Has a listing on npm registry (MCP servers) (5)
-
speclock io.github.sgroy10/speclock
AI Constraint Engine — enforces CLAUDE.md and .cursorrules as laws. 51 MCP tools.
-
One workspace for every AI coding assistant. Shared tasks, memory, and governance.
-
review-assist-mcp io.github.uditk2/review-assist-mcp
Turns an AI coding agent session into a reviewable Intent Document, validated against the diff.
-
mistral-mcp io.github.Swih/mistral-mcp
Mistral MCP server: extract invoices and documents from text, Markdown or OCR into typed JSON.
-
Local coding tools for ChatGPT Developer Mode and MCP clients with safe editing and shell execution.
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Want this mark on your plugin in our catalog?
Prove you maintain it with a file in its repository, a file on your domain or a DNS record, and you can show this mark on the card, with live banners for your site and README. How verification works
You also get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from public marketplace files in GitHub repositories of their authors. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.