designlang
Thirteen slash commands wrapping the designlang CLI: /extract (full design language → DTCG, Tailwind, Figma), /site (crawl a whole site → one canonical design system + consistency…
Plugin-Paket · von Manavarya Singh
Überblick
designlang ist ein Plugin-Paket für KI-Coding-Tools von Manavarya Singh. Marktplätze, die wir lesen und die es listen: 1 (Community GitHub marketplaces). Die letzte erfasste Änderung war am 2026-10-29. Stand unseres Marktplatz-Durchlaufs vom 2026-10-29.
Thirteen slash commands wrapping the designlang CLI: /extract (full design language → DTCG, Tailwind, Figma), /site (crawl a whole site → one canonical design system + consistency grade), /grade (shareable HTML report card + SVG badge), /battle (head-to-head graded comparison), /remix (restyle in 6 vocabularies — brutalist, swiss, art-deco, cyberpunk, soft-ui, editorial), /pack (one downloadable design-system bundle), /theme-swap (OKLCH-correct recolour around a new brand primary), /brand (full editorial brand-guidelines book — 13 chapters, hand-off-ready), /pair (fuse two designs across configurable axes — colours from one site, typography from another), /studio (live token-editor with component preview + export), /verify (rebuild from tokens and pixel-diff vs live for a fidelity score), /fidelity (score a clone vs the original — visual pixel-diff + motion fidelity — with a ranked correction plan), /gallery (build a shareable static gallery of measured clones).
Was es abfragt
- Wird als Plugin-Paket installiert
Keiner der Marktplätze, die wir lesen, veröffentlicht seine Tools oder die abgefragten Einstellungen.
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add manavarya09/design-extract
/plugin install designlang@designlangWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz manavarya09/design-extract (Quelle auf GitHub öffnen) | Gelistet | 13.3.2 | Forks (GitHub): 376 Sterne (GitHub): 4 413 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
In einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| designlang | manavarya09/design-extract | 4 413 |
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
Skills: 1
extract-design
Befehle: 14
battlebranddnaextractfidelitygallerygradepackpairremixsitestudio
Weitere anzeigen: 2
theme-swapverify
Was sich geändert hat
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
A full design suite for Claude Code: 58 brand design systems (Stripe, Linear, Vercel, Google, Anthropic and more) + 5 curated skills for UI/UX generation, accessibility auditing…
-
Builds comprehensive design systems and design bibles with production-ready CSS. Expert in design tokens, component libraries, CSS architecture. Use for design system creation…
-
29 specialized design agents as Claude Code commands. Bring expert design knowledge into every coding session - accessibility, motion design, design systems, color theory…
-
design-system-audit-and-remediation
Identify design debt, audit tokens, and enforce consistency across a product.
-
Advanced frontend design plugin with interactive wizard, trend research, moodboard creation, browser-based inspiration analysis, color/typography selection, and WCAG accessibility
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Analyze design trends and recommend appropriate styles, color palettes, and typography systems for your project based on current design movements. NOT for accessibility auditing…
-
Design tokens from any live site: colours, type, spacing, components, drift against a baseline.
-
Guide AI-assisted UI generation toward enterprise-grade design. Use when building UIs, creating dashboards, designing SaaS applications, or generating styled frontend code…
-
Design principles, legendary designers, and historical movements applied to UI work, with agents and workflows for brand identity, design audits, style guides, and premium landing…
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
A full design suite for Claude Code: 58 brand design systems (Stripe, Linear, Vercel, Google, Anthropic and more) + 5 curated skills for UI/UX generation, accessibility auditing…
-
29 specialized design agents as Claude Code commands. Bring expert design knowledge into every coding session - accessibility, motion design, design systems, color theory…
-
Connect Claude Code to Figma with 46 MCP tools, 20 specialized skills, and 8 commands. Read, write, and analyze Figma designs directly — no REST API token required. Privacy-first…
-
Agent-orchestrated design pipeline for Claude Code. Five stages (brief → discover → plan → design → verify), 33 specialized agents, 12 tool connections including Figma, shadcn/ui…
-
design-drift prevents AI agents from drifting away from your design system in real time. Lock any of existing brands design systems and every Write/Edit to a UI file is…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Create distinctive, production-grade frontend interfaces with high design quality. Generates creative, polished code that avoids generic AI aesthetics.
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Plugin for coding agents working with UI theme designer. Bundles two skills: how-to and conceptual answers about UI theme designer on BTP, and questions about the SAP Design…
Gelistet auf Claude: knowledge-work-plugins (5)
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
B12 plugin with two skills: Website Generator (create a B12 website from a brief description) and B12 Website Editor (edit a live B12 website using Claude's browser access in…
-
Create production-ready Pendo in-app guides (walkthroughs, announcements, alerts, polls, promotions) as HTML/CSS/JS from a short intake conversation, using Pendo's guide…
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
Figma workflows for design implementation, Code Connect templates, and design system rule generation.
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Bring your Canva design workflow into Codex and create, refine, and review designs through natural conversation. Available skills: Resize for social media: Adapt a design for…
-
Use MagicPath to find, inspect, install, create, and edit UI components from Codex.
-
Build web apps with frontend asset design, browser testing, UI components, payments, and database guidance.
Gelistet auf Community GitHub marketplaces (5)
-
Builds comprehensive design systems and design bibles with production-ready CSS. Expert in design tokens, component libraries, CSS architecture. Use for design system creation…
-
design-system-audit-and-remediation
Identify design debt, audit tokens, and enforce consistency across a product.
-
Advanced frontend design plugin with interactive wizard, trend research, moodboard creation, browser-based inspiration analysis, color/typography selection, and WCAG accessibility
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Analyze design trends and recommend appropriate styles, color palettes, and typography systems for your project based on current design movements. NOT for accessibility auditing…
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Equips AI coding agents with knowledge and tooling for working with UI theme designer, the SAP Design System, and SAP Fiori design tokens.
-
Essential prompts, instructions, and chat modes for modern frontend web development including React, Angular, Vue, TypeScript, and CSS frameworks.
-
Build and publish websites, dashboards, reports, and small web tools with Spacefast. Includes skills for editing Spaces, sharing previews, connecting domains, and restoring…
-
Keep your coding agent up to date with the latest web best practices
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
Gelistet auf Cursor: cursor/plugins (5)
-
Generate presentations, documents, and webpages.
-
Render PR diffs as review canvases grouped by importance.
-
Design, build, and edit your Framer sites, pages, and CMS content.
-
Render documentation as a navigable canvas.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
Gelistet auf Docker MCP Catalog (5)
-
Generate images, video, and audio with Glif's media-generation agent
-
Model Context Protocol (MCP) server for the Webflow Data API.
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
Access the latest Astro web framework documentation, guides, and API references.
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
Gelistet auf Official MCP Registry (5)
-
Design tokens from any live site: colours, type, spacing, components, drift against a baseline.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
Curated design references for AI — real CSS values, typography specs, and color palettes.
-
design-system app.zaklad/design-system
Build and manage your design system with AI: tokens, themes, components, icons, Figma and code.
-
Extract a website’s design tokens (colors, type, spacing, shadows) as DESIGN.md, W3C, or CSS.
Gelistet auf PyPI (MCP servers) (5)
-
canva com.mcparmory/canva
Create designs, manage assets, and automate design generation from external workflows
-
canva-mcp io.github.wmarceau/canva-mcp
MCP server for Canva - create designs, manage assets, use templates, export graphics
-
figma com.mcparmory/figma
Export files, access design data, manage projects, comments, and team assets
-
Connect AI assistants to Outline for document search, reading, and management
-
Generate beautiful Excalidraw architecture diagrams with auto-layout and component styling
Gelistet auf npm registry (MCP servers) (5)
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
designer-skill-mcp io.github.PyModel/designer-skill-mcp
UI design MCP: design references, intent routing, anti-slop static detector and gate. No API key.
-
figma-mcp-rust io.github.alvinindra/figma-mcp-rust
Figma MCP server in Rust: plugin bridge, no API token, no rate limits, 73 tools.
-
storeshots-mcp io.github.mtbun/storeshots-mcp
Render store-ready App Store and Google Play screenshots: device frames, headlines, exact sizes.
-
AI-Ready design system MCP: melta UI tokens, component contracts, 107 rules, check_html self-verify
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.