designlang
Thirteen slash commands wrapping the designlang CLI: /extract (full design language → DTCG, Tailwind, Figma), /site (crawl a whole site → one canonical design system + consistency…
Plugin bundle · by Manavarya Singh
About
designlang is a plugin bundle for AI coding tools published by Manavarya Singh. Marketplaces we read that list it: 1 (Community GitHub marketplaces). The last change we recorded was on 2026-10-29. As of our marketplace pass on 2026-10-29.
Thirteen slash commands wrapping the designlang CLI: /extract (full design language → DTCG, Tailwind, Figma), /site (crawl a whole site → one canonical design system + consistency grade), /grade (shareable HTML report card + SVG badge), /battle (head-to-head graded comparison), /remix (restyle in 6 vocabularies — brutalist, swiss, art-deco, cyberpunk, soft-ui, editorial), /pack (one downloadable design-system bundle), /theme-swap (OKLCH-correct recolour around a new brand primary), /brand (full editorial brand-guidelines book — 13 chapters, hand-off-ready), /pair (fuse two designs across configurable axes — colours from one site, typography from another), /studio (live token-editor with component preview + export), /verify (rebuild from tokens and pixel-diff vs live for a fidelity score), /fidelity (score a clone vs the original — visual pixel-diff + motion fidelity — with a ranked correction plan), /gallery (build a shareable static gallery of measured clones).
What it asks for
- Installs as a plugin bundle
None of the marketplaces we read publishes its tools or the settings it asks for.
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Works with
- Claude Code
From the marketplaces that list it and the MCP transport it declares, as each client documents them. We do not test plugins.
Connect
Commands and configs built only from what its marketplaces declare. We do not run them for you and do not test plugins.
As a Claude Code plugin
Built from what Community GitHub marketplaces declares.
/plugin marketplace add manavarya09/design-extract
/plugin install designlang@designlangWhere it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Community marketplace manavarya09/design-extract (Open the source on GitHub) | Listed | 13.3.2 | Forks (GitHub): 376 Stars (GitHub): 4 413 |
Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
Listed in one community marketplace
| Marketplace | Repository | Stars (GitHub) |
|---|---|---|
| designlang | manavarya09/design-extract | 4 413 |
What the bundle contains
As published on Community GitHub marketplaces.
Skills: 1
extract-design
Commands: 14
battlebranddnaextractfidelitygallerygradepackpairremixsitestudio
Show the remaining 2
theme-swapverify
What changed
- Became a product we track
- Community GitHub marketplaces: appeared
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
A full design suite for Claude Code: 58 brand design systems (Stripe, Linear, Vercel, Google, Anthropic and more) + 5 curated skills for UI/UX generation, accessibility auditing…
-
Builds comprehensive design systems and design bibles with production-ready CSS. Expert in design tokens, component libraries, CSS architecture. Use for design system creation…
-
29 specialized design agents as Claude Code commands. Bring expert design knowledge into every coding session - accessibility, motion design, design systems, color theory…
-
design-system-audit-and-remediation
Identify design debt, audit tokens, and enforce consistency across a product.
-
Advanced frontend design plugin with interactive wizard, trend research, moodboard creation, browser-based inspiration analysis, color/typography selection, and WCAG accessibility
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Analyze design trends and recommend appropriate styles, color palettes, and typography systems for your project based on current design movements. NOT for accessibility auditing…
-
Design tokens from any live site: colours, type, spacing, components, drift against a baseline.
-
Guide AI-assisted UI generation toward enterprise-grade design. Use when building UIs, creating dashboards, designing SaaS applications, or generating styled frontend code…
-
Design principles, legendary designers, and historical movements applied to UI work, with agents and workflows for brand identity, design audits, style guides, and premium landing…
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
A full design suite for Claude Code: 58 brand design systems (Stripe, Linear, Vercel, Google, Anthropic and more) + 5 curated skills for UI/UX generation, accessibility auditing…
-
29 specialized design agents as Claude Code commands. Bring expert design knowledge into every coding session - accessibility, motion design, design systems, color theory…
-
Connect Claude Code to Figma with 46 MCP tools, 20 specialized skills, and 8 commands. Read, write, and analyze Figma designs directly — no REST API token required. Privacy-first…
-
Agent-orchestrated design pipeline for Claude Code. Five stages (brief → discover → plan → design → verify), 33 specialized agents, 12 tool connections including Figma, shadcn/ui…
-
design-drift prevents AI agents from drifting away from your design system in real time. Lock any of existing brands design systems and every Write/Edit to a UI file is…
Has a listing on Claude Code: claude-plugins-official (5)
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Create distinctive, production-grade frontend interfaces with high design quality. Generates creative, polished code that avoids generic AI aesthetics.
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Plugin for coding agents working with UI theme designer. Bundles two skills: how-to and conceptual answers about UI theme designer on BTP, and questions about the SAP Design…
Has a listing on Claude: knowledge-work-plugins (5)
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
B12 plugin with two skills: Website Generator (create a B12 website from a brief description) and B12 Website Editor (edit a live B12 website using Claude's browser access in…
-
Create production-ready Pendo in-app guides (walkthroughs, announcements, alerts, polls, promotions) as HTML/CSS/JS from a short intake conversation, using Pendo's guide…
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
Figma workflows for design implementation, Code Connect templates, and design system rule generation.
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Bring your Canva design workflow into Codex and create, refine, and review designs through natural conversation. Available skills: Resize for social media: Adapt a design for…
-
Use MagicPath to find, inspect, install, create, and edit UI components from Codex.
-
Build web apps with frontend asset design, browser testing, UI components, payments, and database guidance.
Has a listing on Community GitHub marketplaces (5)
-
Builds comprehensive design systems and design bibles with production-ready CSS. Expert in design tokens, component libraries, CSS architecture. Use for design system creation…
-
design-system-audit-and-remediation
Identify design debt, audit tokens, and enforce consistency across a product.
-
Advanced frontend design plugin with interactive wizard, trend research, moodboard creation, browser-based inspiration analysis, color/typography selection, and WCAG accessibility
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Analyze design trends and recommend appropriate styles, color palettes, and typography systems for your project based on current design movements. NOT for accessibility auditing…
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Equips AI coding agents with knowledge and tooling for working with UI theme designer, the SAP Design System, and SAP Fiori design tokens.
-
Essential prompts, instructions, and chat modes for modern frontend web development including React, Angular, Vue, TypeScript, and CSS frameworks.
-
Build and publish websites, dashboards, reports, and small web tools with Spacefast. Includes skills for editing Spaces, sharing previews, connecting domains, and restoring…
-
Keep your coding agent up to date with the latest web best practices
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
Has a listing on Cursor: cursor/plugins (5)
-
Generate presentations, documents, and webpages.
-
Render PR diffs as review canvases grouped by importance.
-
Design, build, and edit your Framer sites, pages, and CMS content.
-
Render documentation as a navigable canvas.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
Has a listing on Docker MCP Catalog (5)
-
Generate images, video, and audio with Glif's media-generation agent
-
Model Context Protocol (MCP) server for the Webflow Data API.
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
Access the latest Astro web framework documentation, guides, and API references.
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
Has a listing on Official MCP Registry (5)
-
Design tokens from any live site: colours, type, spacing, components, drift against a baseline.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
Curated design references for AI — real CSS values, typography specs, and color palettes.
-
design-system app.zaklad/design-system
Build and manage your design system with AI: tokens, themes, components, icons, Figma and code.
-
Extract a website’s design tokens (colors, type, spacing, shadows) as DESIGN.md, W3C, or CSS.
Has a listing on PyPI (MCP servers) (5)
-
canva com.mcparmory/canva
Create designs, manage assets, and automate design generation from external workflows
-
canva-mcp io.github.wmarceau/canva-mcp
MCP server for Canva - create designs, manage assets, use templates, export graphics
-
figma com.mcparmory/figma
Export files, access design data, manage projects, comments, and team assets
-
Connect AI assistants to Outline for document search, reading, and management
-
Generate beautiful Excalidraw architecture diagrams with auto-layout and component styling
Has a listing on npm registry (MCP servers) (5)
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
designer-skill-mcp io.github.PyModel/designer-skill-mcp
UI design MCP: design references, intent routing, anti-slop static detector and gate. No API key.
-
figma-mcp-rust io.github.alvinindra/figma-mcp-rust
Figma MCP server in Rust: plugin bridge, no API token, no rate limits, 73 tools.
-
storeshots-mcp io.github.mtbun/storeshots-mcp
Render store-ready App Store and Google Play screenshots: device frames, headlines, exact sizes.
-
AI-Ready design system MCP: melta UI tokens, component contracts, 107 rules, check_html self-verify
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Want this mark on your plugin in our catalog?
Prove you maintain it with a file in its repository, a file on your domain or a DNS record, and you can show this mark on the card, with live banners for your site and README. How verification works
You also get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from public marketplace files in GitHub repositories of their authors. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.