skillengine
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Пакет плагинов · от Borhen Saidi
Коротко
skillengine: пакет плагинов для ИИ-инструментов разработки, издатель Borhen Saidi. Витрин, которые мы читаем и где он опубликован: 1 (Community GitHub marketplaces). Мы впервые увидели его 2026-10-15 и с тех пор изменений не фиксировали. Данные нашего прохода по витринам на 2026-10-15.
Что просит
- Ставится как пакет плагинов
- Хуков: 1
Что объявляет, просит и запускает, полностью
Устанавливайте плагины только от разработчиков, которым доверяете. Мы показываем то, что публикуют витрины, и не проверяем плагины.
Работает с
- Claude Code
По маркетплейсам, где он опубликован, и объявленному транспорту MCP, как их документирует каждый клиент. Плагины мы не тестируем.
Подключить
Команды и конфигурации собраны только из того, что объявляют витрины. Мы не запускаем их за вас и не проверяем плагины.
Как плагин Claude Code
Собрано из того, что объявляет Community GitHub marketplaces.
/plugin marketplace add borhen68/skillengine
/plugin install skillengine@borhen-skillengineГде опубликован
| Витрина | Статус | Версия | Числа | Проверен | Впервые замечен |
|---|---|---|---|---|---|
| Маркетплейс сообщества borhen68/skillengine (Открыть исходники на GitHub) | Опубликован | не указана | Число не опубликовано | Не помечен |
Каждое число принадлежит своей витрине и никогда не складывается с числами других витрин. Если витрина число не публикует, мы его не показываем: нет числа не значит ноль.
Есть в одном маркетплейсе сообщества
| Витрина | Репозиторий | Звёзды (GitHub) |
|---|---|---|
| borhen-skillengine | borhen68/skillengine | 17 |
Что входит в пакет
Так опубликовано на витрине Community GitHub marketplaces.
Скиллы: 28
ai-opsapi-and-interface-designbrowser-testing-with-devtoolschaos-engineeringci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringcost-optimizationdata-engineeringdebugging-and-error-recoverydeprecation-and-migration
Показать остальные 16
documentation-and-adrsdoubt-driven-developmentfrontend-ui-engineeringgit-workflow-and-versioningidea-refineincremental-implementationinterview-meobservability-and-instrumentationperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Команды: 8
buildcode-simplifyplanreviewshipspectestwebperf
Агенты: 4
code-reviewersecurity-auditortest-engineerweb-performance-auditor
Хуки: 1
SessionStart
Что менялось
- Стал продуктом, за которым мы следим
- Community GitHub marketplaces: появился
Похожие плагины
Продукты, чьи собственные названия, описания, инструменты и скиллы ближе всего по смыслу к этому, на всех витринах, которые мы читаем. Близость упорядочена только внутри этого списка.
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
-
Public Builder skills for docs-first discipline, autonomous execution, cross-agent review, local-first Rewind memory, efficient agent workflows, clear status recaps, Agent-Native…
-
37 advanced engineering skills: agent designer, agent workflow designer, RAG architect, database designer + schema designer + SQL assistant, migration architect, observability…
-
Architecture, engineering delivery, development discipline, debugging, review, and AI and automation systems.
-
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Похожие плагины по витринам
Тот же вопрос к каждой витрине по отдельности: есть ли там аналог этого плагина?
Есть на витрине Claude Code: claude-plugins-community (5)
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
Complete CTO & Staff Engineer toolkit: 24 skills covering code review, architecture, DevOps, security, testing, and engineering management
-
Engineering lifecycle, DevOps, operations, reliability, security, architecture, and maintainability skills with automatic routing.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
14 skills for all software engineering work. Not just greenfield builds. Build a complete SaaS from scratch, add a feature to existing code, harden before launch, set up CI/CD…
Есть на витрине Claude Code: claude-plugins-official (5)
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
Superpowers teaches Claude brainstorming, subagent driven development with built in code review, systematic debugging, and red/green TDD. Additionally, it teaches Claude how to…
-
Create new skills, improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, update or optimize an existing skill, run evals to…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Forge-focused skills and MCP configuration for Atlassian Forge: scaffold and deploy apps (forge create, templates, dev spaces), build Teamwork Graph connectors for Rovo…
Есть на витрине Claude: knowledge-work-plugins (5)
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
DataRobot skills for AI/ML workflows — model training, deployment, predictions, feature engineering, monitoring, explainability, data preparation, App Framework CI/CD, and…
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
Есть на витрине Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Qodo setup, code intelligence, and review workflows.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Есть на витрине Community GitHub marketplaces (5)
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
Есть на витрине Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Design, build, review, and publish GitHub Skills-style exercises with one coordinating agent and five Agent Skills for learner journeys, workflow-backed validation, and release…
-
Helps GitHub Copilot investigate mobile app telemetry, diagnose crashes, manage [bitdrift](bitdrift.ai) workflows and dashboards, integrate the Capture SDK into iOS, Android, and…
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
Есть на витрине Copilot CLI: github/copilot-plugins (5)
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Есть на витрине Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Build apps, scripts, and automations with the TypeScript SDK.
Есть на витрине Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
-
MCP server for terminal commands, file operations, and process management
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Есть на витрине Official MCP Registry (5)
-
Composable skill packets, harvests, workflow routing, and release/audit rubrics over MCP.
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
Toolbox for AI agent skills: scaffold, lint, pack, install, and serve SKILL.md skills
-
Sigistry Plugin & Skill Catalog
Search verified Claude Code plugins and skills; fetch portable SKILL.md sources. Read-only.
-
Agent-first skill marketplace with USK open standard for Claude, Cursor, Gemini, Codex CLI.
Найдено по смыслу, а не по общему коду или репозиторию: похожие плагины остаются разными продуктами, и это не обзор и не рекомендация.
Хотите такой знак у своего плагина в нашем каталоге?
Докажите, что поддерживаете его, файлом в репозитории, файлом на вашем домене или DNS-записью, и сможете показать этот знак на карточке, а ещё живые баннеры для сайта и README. Как проходит подтверждение
Ещё вы будете получать уведомления, когда витрина добавит плагин, снимет его, изменит отметку verified или список того, что он просит, а его удалённый endpoint встанет на мониторинг как веб-сервис.
Данные витрины Community GitHub marketplaces. Числа взяты из наших регулярных обходов витрин, последняя проверка . Контакты издателей плагинов мы не публикуем.