skillengine
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Lot de plugins · par Borhen Saidi
Aperçu
skillengine est un lot de plugins pour les outils de code IA publié par Borhen Saidi. Places de marché que nous lisons et qui le référencent : 1 (Community GitHub marketplaces). Nous l'avons vu pour la première fois le 2026-10-15 et n'avons enregistré aucun changement depuis. Selon notre passage sur les places de marché du 2026-10-15.
Ce qu'il demande
- S'installe comme lot de plugins
- Hooks : 1
Ce qu'il déclare, demande et exécute, en détail
N’installez que des plugins de développeurs en qui vous avez confiance. Nous reprenons ce que publient les places de marché et ne testons pas les plugins.
Fonctionne avec
- Claude Code
D'après les marketplaces qui le listent et le transport MCP qu'il déclare, tels que chaque client les documente. Nous ne testons pas les plugins.
Connecter
Commandes et configurations construites uniquement à partir de ce que déclarent ses places de marché. Nous ne les exécutons pas pour vous et ne testons pas les plugins.
En plugin Claude Code
Construit à partir de ce que déclare Community GitHub marketplaces.
/plugin marketplace add borhen68/skillengine
/plugin install skillengine@borhen-skillengineOù il est publié
| Place de marché | Statut | Version | Chiffres | Vérifié | Vu pour la première fois |
|---|---|---|---|---|---|
| Place de marché communautaire borhen68/skillengine (Ouvrir la source sur GitHub) | Référencé | non indiquée | Forks (GitHub): 4 Étoiles (GitHub): 17 |
Non marqué |
Chaque chiffre est celui de la place de marché et n'est jamais additionné entre places de marché. Une place de marché qui ne publie pas de chiffre n'en affiche aucun : pas de nombre ne veut pas dire zéro.
Listé dans une place de marché communautaire
| Place de marché | Dépôt | Étoiles (GitHub) |
|---|---|---|
| borhen-skillengine | borhen68/skillengine | 17 |
Quelles places de marché nous lisons et comment nous les vérifions
Ce que contient le lot
Tel que publié sur Community GitHub marketplaces.
Skills: 28
ai-opsapi-and-interface-designbrowser-testing-with-devtoolschaos-engineeringci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringcost-optimizationdata-engineeringdebugging-and-error-recoverydeprecation-and-migration
Afficher les autres : 16
documentation-and-adrsdoubt-driven-developmentfrontend-ui-engineeringgit-workflow-and-versioningidea-refineincremental-implementationinterview-meobservability-and-instrumentationperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Commandes: 8
buildcode-simplifyplanreviewshipspectestwebperf
Agents: 4
code-reviewersecurity-auditortest-engineerweb-performance-auditor
Hooks: 1
SessionStart
Ce qui a changé
- Est devenu un produit que nous suivons
- Community GitHub marketplaces: apparu
Plugins similaires
Produits dont les noms, descriptions, outils et skills sont les plus proches de celui-ci par le sens, sur toutes les places de marché que nous lisons. La proximité n'est classée qu'à l'intérieur de cette liste.
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
-
Public Builder skills for docs-first discipline, autonomous execution, cross-agent review, local-first Rewind memory, efficient agent workflows, clear status recaps, Agent-Native…
-
37 advanced engineering skills: agent designer, agent workflow designer, RAG architect, database designer + schema designer + SQL assistant, migration architect, observability…
-
Architecture, engineering delivery, development discipline, debugging, review, and AI and automation systems.
-
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Plugins similaires par place de marché
La même question posée à chaque place de marché séparément : y a-t-il là un équivalent de ce plugin ?
Référencé sur Claude Code: claude-plugins-community (5)
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
Complete CTO & Staff Engineer toolkit: 24 skills covering code review, architecture, DevOps, security, testing, and engineering management
-
Engineering lifecycle, DevOps, operations, reliability, security, architecture, and maintainability skills with automatic routing.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
14 skills for all software engineering work. Not just greenfield builds. Build a complete SaaS from scratch, add a feature to existing code, harden before launch, set up CI/CD…
Référencé sur Claude Code: claude-plugins-official (5)
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
Superpowers teaches Claude brainstorming, subagent driven development with built in code review, systematic debugging, and red/green TDD. Additionally, it teaches Claude how to…
-
Create new skills, improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, update or optimize an existing skill, run evals to…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Forge-focused skills and MCP configuration for Atlassian Forge: scaffold and deploy apps (forge create, templates, dev spaces), build Teamwork Graph connectors for Rovo…
Référencé sur Claude: knowledge-work-plugins (5)
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
DataRobot skills for AI/ML workflows — model training, deployment, predictions, feature engineering, monitoring, explainability, data preparation, App Framework CI/CD, and…
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
Référencé sur Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Qodo setup, code intelligence, and review workflows.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Référencé sur Community GitHub marketplaces (5)
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
Référencé sur Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Design, build, review, and publish GitHub Skills-style exercises with one coordinating agent and five Agent Skills for learner journeys, workflow-backed validation, and release…
-
Helps GitHub Copilot investigate mobile app telemetry, diagnose crashes, manage [bitdrift](bitdrift.ai) workflows and dashboards, integrate the Capture SDK into iOS, Android, and…
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
Référencé sur Copilot CLI: github/copilot-plugins (5)
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Référencé sur Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Build apps, scripts, and automations with the TypeScript SDK.
Référencé sur Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
-
MCP server for terminal commands, file operations, and process management
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Référencé sur Official MCP Registry (5)
-
Composable skill packets, harvests, workflow routing, and release/audit rubrics over MCP.
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
Toolbox for AI agent skills: scaffold, lint, pack, install, and serve SKILL.md skills
-
Sigistry Plugin & Skill Catalog
Search verified Claude Code plugins and skills; fetch portable SKILL.md sources. Read-only.
-
Agent-first skill marketplace with USK open standard for Claude, Cursor, Gemini, Codex CLI.
Trouvés par le sens, et non par un code ou un dépôt commun : les plugins similaires restent des produits distincts, et ceci n'est ni un avis ni une recommandation.
Vous voulez cette marque pour votre plugin dans notre catalogue ?
Prouvez que vous le maintenez avec un fichier dans son dépôt, un fichier sur votre domaine ou un enregistrement DNS, et vous pourrez afficher cette marque sur la fiche, avec des bannières à jour pour votre site et votre README. Comment se passe la vérification
Vous recevez aussi des alertes quand une marketplace le publie, le retire, change sa marque vérifiée ou ce qu'il demande, et son endpoint distant est surveillé comme un service web.
Données issues de Community GitHub marketplaces. Les chiffres proviennent de nos propres passages réguliers sur les places de marché, dernière lecture le . Nous ne publions aucune coordonnée des éditeurs de plugins.