skillengine
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Paquete de plugins · de Borhen Saidi
Resumen
skillengine es un paquete de plugins para herramientas de programación con IA publicado por Borhen Saidi. Marketplaces que leemos y que lo publican: 1 (Community GitHub marketplaces). Lo vimos por primera vez el 2026-10-15 y desde entonces no hemos registrado cambios. Según nuestra pasada por los marketplaces del 2026-10-15.
Qué pide
- Se instala como paquete de plugins
- Hooks declarados: 1
Lo que declara, pide y ejecuta, completo
Instala solo plugins de desarrolladores en los que confíes. Mostramos lo que publican los marketplaces y no probamos plugins.
Funciona con
- Claude Code
Según los marketplaces que lo listan y el transporte MCP que declara, tal como lo documenta cada cliente. No probamos plugins.
Conectar
Comandos y configuraciones generados solo a partir de lo que declaran sus marketplaces. No los ejecutamos por ti ni probamos plugins.
Como plugin de Claude Code
Generado a partir de lo que declara Community GitHub marketplaces.
/plugin marketplace add borhen68/skillengine
/plugin install skillengine@borhen-skillengineDónde está publicado
| Marketplace | Estado | Versión | Cifras | Verificado | Visto por primera vez |
|---|---|---|---|---|---|
| Marketplace de la comunidad borhen68/skillengine (Abrir el código en GitHub) | Publicado | sin indicar | Forks (GitHub): 4 Estrellas (GitHub): 17 |
Sin marca |
Cada cifra es del propio marketplace y nunca se suma entre marketplaces. Un marketplace que no publica cifras no muestra ninguna: sin número no es cero.
Figura en un marketplace de la comunidad
| Marketplace | Repositorio | Estrellas (GitHub) |
|---|---|---|
| borhen-skillengine | borhen68/skillengine | 17 |
Qué contiene el paquete
Tal como se publica en Community GitHub marketplaces.
Skills: 28
ai-opsapi-and-interface-designbrowser-testing-with-devtoolschaos-engineeringci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringcost-optimizationdata-engineeringdebugging-and-error-recoverydeprecation-and-migration
Mostrar los otros 16
documentation-and-adrsdoubt-driven-developmentfrontend-ui-engineeringgit-workflow-and-versioningidea-refineincremental-implementationinterview-meobservability-and-instrumentationperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Comandos: 8
buildcode-simplifyplanreviewshipspectestwebperf
Agentes: 4
code-reviewersecurity-auditortest-engineerweb-performance-auditor
Hooks: 1
SessionStart
Qué cambió
- Pasó a ser un producto que seguimos
- Community GitHub marketplaces: apareció
Plugins similares
Productos cuyos propios nombres, descripciones, herramientas y skills son los más cercanos a este por su significado, en todos los marketplaces que leemos. La cercanía se ordena solo dentro de esta lista.
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
-
Public Builder skills for docs-first discipline, autonomous execution, cross-agent review, local-first Rewind memory, efficient agent workflows, clear status recaps, Agent-Native…
-
37 advanced engineering skills: agent designer, agent workflow designer, RAG architect, database designer + schema designer + SQL assistant, migration architect, observability…
-
Architecture, engineering delivery, development discipline, debugging, review, and AI and automation systems.
-
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Plugins similares por marketplace
La misma pregunta a cada marketplace por separado: ¿hay allí un equivalente de este plugin?
Publicado en Claude Code: claude-plugins-community (5)
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
Complete CTO & Staff Engineer toolkit: 24 skills covering code review, architecture, DevOps, security, testing, and engineering management
-
Engineering lifecycle, DevOps, operations, reliability, security, architecture, and maintainability skills with automatic routing.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
14 skills for all software engineering work. Not just greenfield builds. Build a complete SaaS from scratch, add a feature to existing code, harden before launch, set up CI/CD…
Publicado en Claude Code: claude-plugins-official (5)
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
Superpowers teaches Claude brainstorming, subagent driven development with built in code review, systematic debugging, and red/green TDD. Additionally, it teaches Claude how to…
-
Create new skills, improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, update or optimize an existing skill, run evals to…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Forge-focused skills and MCP configuration for Atlassian Forge: scaffold and deploy apps (forge create, templates, dev spaces), build Teamwork Graph connectors for Rovo…
Publicado en Claude: knowledge-work-plugins (5)
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
DataRobot skills for AI/ML workflows — model training, deployment, predictions, feature engineering, monitoring, explainability, data preparation, App Framework CI/CD, and…
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
Publicado en Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Qodo setup, code intelligence, and review workflows.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Publicado en Community GitHub marketplaces (5)
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
Publicado en Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Design, build, review, and publish GitHub Skills-style exercises with one coordinating agent and five Agent Skills for learner journeys, workflow-backed validation, and release…
-
Helps GitHub Copilot investigate mobile app telemetry, diagnose crashes, manage [bitdrift](bitdrift.ai) workflows and dashboards, integrate the Capture SDK into iOS, Android, and…
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
Publicado en Copilot CLI: github/copilot-plugins (5)
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Publicado en Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Build apps, scripts, and automations with the TypeScript SDK.
Publicado en Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
-
MCP server for terminal commands, file operations, and process management
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Publicado en Official MCP Registry (5)
-
Composable skill packets, harvests, workflow routing, and release/audit rubrics over MCP.
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
Toolbox for AI agent skills: scaffold, lint, pack, install, and serve SKILL.md skills
-
Sigistry Plugin & Skill Catalog
Search verified Claude Code plugins and skills; fetch portable SKILL.md sources. Read-only.
-
Agent-first skill marketplace with USK open standard for Claude, Cursor, Gemini, Codex CLI.
Encontrados por significado, no por código ni repositorio compartidos: los plugins similares siguen siendo productos distintos, y esto no es una reseña ni una recomendación.
¿Quieres esta marca para tu plugin en nuestro catálogo?
Demuestra que lo mantienes con un archivo en su repositorio, un archivo en tu dominio o un registro DNS, y podrás mostrar esta marca en la ficha, con banners en vivo para tu web y tu README. Cómo funciona la verificación
Además recibirás avisos cuando un marketplace lo publique, lo retire, cambie su marca verificada o lo que pide, y su endpoint remoto quedará monitorizado como un servicio web.
Datos de Community GitHub marketplaces. Las cifras proceden de nuestros propios recorridos periódicos por los marketplaces, leída por última vez el . No publicamos datos de contacto de los editores de plugins.