skillengine
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Pacote de plugins · de Borhen Saidi
Resumo
skillengine é um pacote de plugins para ferramentas de programação com IA publicado por Borhen Saidi. Marketplaces que lemos e que o listam: 1 (Community GitHub marketplaces). Vimos pela primeira vez em 2026-10-15 e não registramos mudanças desde então. Conforme nossa passagem pelos marketplaces em 2026-10-15.
O que pede
- Instala-se como pacote de plugins
- Hooks declarados: 1
O que declara, pede e executa, por completo
Instale apenas plugins de desenvolvedores em quem você confia. Mostramos o que os marketplaces publicam e não testamos plugins.
Funciona com
- Claude Code
Pelos marketplaces que o listam e pelo transporte MCP que declara, conforme cada cliente documenta. Não testamos plugins.
Conectar
Comandos e configurações gerados apenas a partir do que os marketplaces declaram. Não os executamos por você e não testamos plugins.
Como plugin do Claude Code
Gerado a partir do que Community GitHub marketplaces declara.
/plugin marketplace add borhen68/skillengine
/plugin install skillengine@borhen-skillengineOnde está publicado
| Marketplace | Status | Versão | Números | Verificado | Visto pela primeira vez |
|---|---|---|---|---|---|
| Marketplace da comunidade borhen68/skillengine (Abrir o código no GitHub) | Listado | não informada | Forks (GitHub): 4 Estrelas (GitHub): 17 |
Sem marcação |
Cada número é do próprio marketplace e nunca é somado entre marketplaces. Um marketplace que não publica números não mostra nenhum: sem número não é zero.
Listado em um marketplace da comunidade
| Marketplace | Repositório | Estrelas (GitHub) |
|---|---|---|
| borhen-skillengine | borhen68/skillengine | 17 |
O que o pacote contém
Conforme publicado em Community GitHub marketplaces.
Skills: 28
ai-opsapi-and-interface-designbrowser-testing-with-devtoolschaos-engineeringci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringcost-optimizationdata-engineeringdebugging-and-error-recoverydeprecation-and-migration
Mostrar mais 16
documentation-and-adrsdoubt-driven-developmentfrontend-ui-engineeringgit-workflow-and-versioningidea-refineincremental-implementationinterview-meobservability-and-instrumentationperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Comandos: 8
buildcode-simplifyplanreviewshipspectestwebperf
Agentes: 4
code-reviewersecurity-auditortest-engineerweb-performance-auditor
Hooks: 1
SessionStart
O que mudou
- Passou a ser um produto que acompanhamos
- Community GitHub marketplaces: apareceu
Plugins semelhantes
Produtos cujos próprios nomes, descrições, ferramentas e skills são os mais próximos deste pelo significado, em todos os marketplaces que lemos. A proximidade é ordenada apenas dentro desta lista.
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
-
Public Builder skills for docs-first discipline, autonomous execution, cross-agent review, local-first Rewind memory, efficient agent workflows, clear status recaps, Agent-Native…
-
37 advanced engineering skills: agent designer, agent workflow designer, RAG architect, database designer + schema designer + SQL assistant, migration architect, observability…
-
Architecture, engineering delivery, development discipline, debugging, review, and AI and automation systems.
-
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Plugins semelhantes por marketplace
A mesma pergunta feita a cada marketplace separadamente: existe lá um equivalente deste plugin?
Listado em Claude Code: claude-plugins-community (5)
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
Complete CTO & Staff Engineer toolkit: 24 skills covering code review, architecture, DevOps, security, testing, and engineering management
-
Engineering lifecycle, DevOps, operations, reliability, security, architecture, and maintainability skills with automatic routing.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
14 skills for all software engineering work. Not just greenfield builds. Build a complete SaaS from scratch, add a feature to existing code, harden before launch, set up CI/CD…
Listado em Claude Code: claude-plugins-official (5)
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
Superpowers teaches Claude brainstorming, subagent driven development with built in code review, systematic debugging, and red/green TDD. Additionally, it teaches Claude how to…
-
Create new skills, improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, update or optimize an existing skill, run evals to…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Forge-focused skills and MCP configuration for Atlassian Forge: scaffold and deploy apps (forge create, templates, dev spaces), build Teamwork Graph connectors for Rovo…
Listado em Claude: knowledge-work-plugins (5)
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
DataRobot skills for AI/ML workflows — model training, deployment, predictions, feature engineering, monitoring, explainability, data preparation, App Framework CI/CD, and…
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
Listado em Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Qodo setup, code intelligence, and review workflows.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Listado em Community GitHub marketplaces (5)
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
Listado em Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Design, build, review, and publish GitHub Skills-style exercises with one coordinating agent and five Agent Skills for learner journeys, workflow-backed validation, and release…
-
Helps GitHub Copilot investigate mobile app telemetry, diagnose crashes, manage [bitdrift](bitdrift.ai) workflows and dashboards, integrate the Capture SDK into iOS, Android, and…
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
Listado em Copilot CLI: github/copilot-plugins (5)
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Listado em Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Build apps, scripts, and automations with the TypeScript SDK.
Listado em Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
-
MCP server for terminal commands, file operations, and process management
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Listado em Official MCP Registry (5)
-
Composable skill packets, harvests, workflow routing, and release/audit rubrics over MCP.
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
Toolbox for AI agent skills: scaffold, lint, pack, install, and serve SKILL.md skills
-
Sigistry Plugin & Skill Catalog
Search verified Claude Code plugins and skills; fetch portable SKILL.md sources. Read-only.
-
Agent-first skill marketplace with USK open standard for Claude, Cursor, Gemini, Codex CLI.
Encontrados pelo significado, não por código ou repositório em comum: plugins semelhantes continuam sendo produtos distintos, e isto não é uma avaliação nem uma recomendação.
Quer esta marca no seu plugin em nosso catálogo?
Prove que o mantém com um arquivo no repositório, um arquivo no seu domínio ou um registro DNS, e você poderá mostrar esta marca na ficha, com banners ao vivo para o seu site e o README. Como funciona a verificação
Você também recebe alertas quando um marketplace o publica, o remove, muda a marca de verificado ou o que ele pede, e o endpoint remoto passa a ser monitorado como um serviço web.
Dados de Community GitHub marketplaces. Os números vêm das nossas próprias passagens regulares pelos marketplaces, última leitura em . Não publicamos dados de contato dos editores de plugins.