skillengine
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Plugin-Paket · von Borhen Saidi
Überblick
skillengine ist ein Plugin-Paket für KI-Coding-Tools von Borhen Saidi. Marktplätze, die wir lesen und die es listen: 1 (Community GitHub marketplaces). Wir haben es erstmals am 2026-10-15 gesehen und seither keine Änderung erfasst. Stand unseres Marktplatz-Durchlaufs vom 2026-10-15.
Was es abfragt
- Wird als Plugin-Paket installiert
- Deklarierte Hooks: 1
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add borhen68/skillengine
/plugin install skillengine@borhen-skillengineWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz borhen68/skillengine (Quelle auf GitHub öffnen) | Gelistet | nicht angegeben | Forks (GitHub): 4 Sterne (GitHub): 17 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
In einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| borhen-skillengine | borhen68/skillengine | 17 |
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
Skills: 28
ai-opsapi-and-interface-designbrowser-testing-with-devtoolschaos-engineeringci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringcost-optimizationdata-engineeringdebugging-and-error-recoverydeprecation-and-migration
Weitere anzeigen: 16
documentation-and-adrsdoubt-driven-developmentfrontend-ui-engineeringgit-workflow-and-versioningidea-refineincremental-implementationinterview-meobservability-and-instrumentationperformance-optimizationplanning-and-task-breakdownsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Befehle: 8
buildcode-simplifyplanreviewshipspectestwebperf
Agenten: 4
code-reviewersecurity-auditortest-engineerweb-performance-auditor
Hooks: 1
SessionStart
Was sich geändert hat
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
-
Public Builder skills for docs-first discipline, autonomous execution, cross-agent review, local-first Rewind memory, efficient agent workflows, clear status recaps, Agent-Native…
-
37 advanced engineering skills: agent designer, agent workflow designer, RAG architect, database designer + schema designer + SQL assistant, migration architect, observability…
-
Architecture, engineering delivery, development discipline, debugging, review, and AI and automation systems.
-
Production-grade engineering skills covering every phase of software development: spec, plan, build, verify, review, and ship.
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
8 flagship engineering skills curated from the Claude Skills library, covering the full shipping flow: architecture (senior-fullstack), delivery (senior-devops…
-
Complete CTO & Staff Engineer toolkit: 24 skills covering code review, architecture, DevOps, security, testing, and engineering management
-
Engineering lifecycle, DevOps, operations, reliability, security, architecture, and maintainability skills with automatic routing.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
14 skills for all software engineering work. Not just greenfield builds. Build a complete SaaS from scratch, add a feature to existing code, harden before launch, set up CI/CD…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
-
Superpowers teaches Claude brainstorming, subagent driven development with built in code review, systematic debugging, and red/green TDD. Additionally, it teaches Claude how to…
-
Create new skills, improve existing skills, and measure skill performance. Use when users want to create a skill from scratch, update or optimize an existing skill, run evals to…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Forge-focused skills and MCP configuration for Atlassian Forge: scaffold and deploy apps (forge create, templates, dev spaces), build Teamwork Graph connectors for Rovo…
Gelistet auf Claude: knowledge-work-plugins (5)
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
DataRobot skills for AI/ML workflows — model training, deployment, predictions, feature engineering, monitoring, explainability, data preparation, App Framework CI/CD, and…
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Qodo setup, code intelligence, and review workflows.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Gelistet auf Community GitHub marketplaces (5)
-
38 advanced engineering skills: agent designer, agent workflow designer, AgentHub, RAG architect, database designer, focused-fix, browser-automation, spec-driven-workflow…
-
36 engineering skills: architecture, frontend, backend, fullstack, QA, DevOps, security, AI/ML, data engineering, Playwright (9 sub-skills), self-improving agent, Stripe…
-
92 engineering skills: architecture, fullstack, DevOps, security, AI/ML, data engineering, and agent tooling
-
Loops (a file-based knowledge base) + a codebase harness (dev-local, e2e, crabbox cloud boxes, verify-before-ship) so agents can run, test, and ship code autonomously.
-
Validated engineering workflow skills plus tiered subagents (reviewer, security auditor, bug hunter, test writer, mechanical editor). Every skill doubles as a slash command; every…
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Design, build, review, and publish GitHub Skills-style exercises with one coordinating agent and five Agent Skills for learner journeys, workflow-backed validation, and release…
-
Helps GitHub Copilot investigate mobile app telemetry, diagnose crashes, manage [bitdrift](bitdrift.ai) workflows and dashboards, integrate the Capture SDK into iOS, Android, and…
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Advanced Security plugin for GitHub Copilot.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Gelistet auf Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Build apps, scripts, and automations with the TypeScript SDK.
Gelistet auf Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
-
MCP server for terminal commands, file operations, and process management
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Gelistet auf Official MCP Registry (5)
-
Composable skill packets, harvests, workflow routing, and release/audit rubrics over MCP.
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
Toolbox for AI agent skills: scaffold, lint, pack, install, and serve SKILL.md skills
-
Sigistry Plugin & Skill Catalog
Search verified Claude Code plugins and skills; fetch portable SKILL.md sources. Read-only.
-
Agent-first skill marketplace with USK open standard for Claude, Cursor, Gemini, Codex CLI.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.