oh-my-claudecode
Claude Code native multi-agent orchestration with intelligent model routing across agents and skills. Zero learning curve. Maximum power.
Plugin-Paket · von Yeachan Heo
Überblick
oh-my-claudecode ist ein Plugin-Paket für KI-Coding-Tools von Yeachan Heo. Marktplätze, die wir lesen und die es listen: 1 (Community GitHub marketplaces). Wir haben es erstmals am 2026-11-11 gesehen und seither keine Änderung erfasst. Stand unseres Marktplatz-Durchlaufs vom 2026-11-11.
Was es abfragt
- Wird als Plugin-Paket installiert
- Deklarierte Hooks: 30
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add yeachan-heo/oh-my-claudecode
/plugin install oh-my-claudecode@omcWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz yeachan-heo/oh-my-claudecode (Quelle auf GitHub öffnen) | Gelistet | 5.8.6 | Keine Zahl veröffentlicht | Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
In einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| omc | yeachan-heo/oh-my-claudecode | 40 759 |
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
MCP-Server: 1
t
Skills: 84
agent-doc-disciplineai-slop-cleanerarchitectarchitecture-surveyarenaaskask-navigatorautopilotautoresearchbabysitbenchmark-checklistblast-radius
Weitere anzeigen: 72
brocancelconfigure-notificationscorrectcreate-formal-verification-skillcreate-verification-skilldebugdeep-interviewdeepinitdiagramdrydockexecuteexternal-contextfigure-it-outfix-cifix-merge-conflictsget-pr-commentsgraphharborhillclimbhowhudin-your-own-wordsintentinterrogateketchupketchup-videolaunchloftmaintain-formal-verification-skillmaintain-verification-skillmapminimal-code-disciplineminimal-prose-disciplinemodelsomc-doctoromc-setuppersonal-modeplanprprinciplesproject-session-managerralphralplanrecallrefitreflectreleaserememberresearchreviewsddself-improvesession-flowsharpenshow-me-your-workskillskillifystacked-deliverystatecharttddteachteamtechnical-writingtracetypescript-best-practicesultragoalverifyvisual-verdictwhat-did-i-get-donewhywiki
Befehle: 21
askautoresearchcompactconfigure-notificationsdebugdeepinitexternal-contexthudomc-doctoromc-setupproject-session-managerpsm
Weitere anzeigen: 9
releaserememberself-improveskillskillifytraceverifyvisual-verdictwiki
Agenten: 19
analystarchitectcode-reviewercode-simplifiercriticdebuggerdesignerdocument-specialistexecutorexploregit-masterplanner
Weitere anzeigen: 7
qa-testerscientistsecurity-reviewertest-engineertracerverifierwriter
Hooks: 11
PermissionRequestPostToolUsePostToolUseFailurePreCompactPreToolUseSessionEndSessionStartStopSubagentStartSubagentStopUserPromptSubmit
Was sich geändert hat
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Opinionated Claude Code plugin for ultrawork, orchestration guardrails, and review gates.
-
Essential agents and skills for Claude Code workflows - git commits, code simplification, security audits, verified multi-lens code review, thermo-nuclear code-quality review…
-
Transform Claude Code into a structured development platform with 25 commands, 15 specialized agents, 7 behavioral modes, and 8 MCP server integrations
-
Routes Claude Code tasks to focused prompts and adds deterministic documentation, skill, release, safety, and capability-audit workflows.
-
Use Copilot from Claude Code to review code or delegate tasks.
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
23 reusable skills, 2 agents, and smart hooks for any project. Covers the full development cycle: architecture mapping, implementation planning, code review, safe refactoring…
-
Self-improving Claude Code, Codex, and OpenCode plugin that turns corrections and successful workflows into Preferences, Project-specific skills, and Shared skills
-
Grok Build ↔ Claude Code bridge for review, critique, and delegation.
-
Complete collection of agents, skills, hooks, commands, and rules evolved over 10+ months of intensive daily use
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
23 reusable skills, 2 agents, and smart hooks for any project. Covers the full development cycle: architecture mapping, implementation planning, code review, safe refactoring…
-
Autonomous PM for Claude Code. Delegate coding tasks to your local Claude Code CLI, iterate with session resumption, keep a running project state without burning orchestrator…
-
Session-level orchestration for Claude Code - structures development work into 5 typed waves (Discovery → Core → Polish → Quality → Finalization) with parallel subagent execution…
-
Guild turns Claude Code into a self-evolving team of specialist agents for larger software tasks. It plans before execution, selects the right specialists, assembles focused…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Gelistet auf Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
gk-cli com.gitkraken/gk-cli
The GitKraken MCP Server for managing repos, PRs, issues across GitHub, GitLab, Bitbucket and more.
-
MCP server for terminal commands, file operations, and process management
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
AI-powered code review in Codex, powered by CodeRabbit.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Inspect repositories, triage pull requests and issues, debug CI, and publish changes through a hybrid GitHub connector and CLI workflow.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Qodo setup, code intelligence, and review workflows.
Gelistet auf Community GitHub marketplaces (5)
-
Opinionated Claude Code plugin for ultrawork, orchestration guardrails, and review gates.
-
Essential agents and skills for Claude Code workflows - git commits, code simplification, security audits, verified multi-lens code review, thermo-nuclear code-quality review…
-
Transform Claude Code into a structured development platform with 25 commands, 15 specialized agents, 7 behavioral modes, and 8 MCP server integrations
-
Routes Claude Code tasks to focused prompts and adds deterministic documentation, skill, release, safety, and capability-audit workflows.
-
Use Copilot from Claude Code to review code or delegate tasks.
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Generic cross-repo command center canvas for GitHub Copilot with onboarding, focus planning, repo health, work signals, and session cleanup.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Model, visualize, and deploy applications with Radius from the GitHub Copilot app and CLI.
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Advanced Security plugin for GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Navigate and interact with your C++ code using the Microsoft C++ Language Server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Gelistet auf Cursor: cursor/plugins (5)
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Gelistet auf Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
MCP server for terminal commands, file operations, and process management
-
Tools for interacting with the GitHub API, enabling file operations, repository management, search functionality, and more.
Gelistet auf Official MCP Registry (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
Gives AI agents the function they asked for, not the file. Commercial use needs a license.
-
Grow your skills with AI: per-skill coaching inside Claude, ChatGPT, Cursor and Codex
-
Search and run hosted AI agent skills for Claude Code, Codex, Cursor and Gemini CLI.
-
consult io.github.neelsatyavolu/consult
Get a second opinion on your code from every coding agent you have. No API keys.
Gelistet auf PyPI (MCP servers) (5)
-
Gives AI agents the function they asked for, not the file. Commercial use needs a license.
-
Let one coding-agent CLI consult another: Codex, Claude Code, OpenCode, Copilot or Antigravity.
-
repo-graph io.github.James-Chahwan/repo-graph
Structural graph map of any codebase so LLMs navigate by structure, not guesswork.
-
A code intelligence graph that gives AI coding agents deep, token-efficient understanding of your codebase.
-
Zero-config MCP server for searchable documentation. SQLite or PostgreSQL.
Gelistet auf npm registry (MCP servers) (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
consult io.github.neelsatyavolu/consult
Get a second opinion on your code from every coding agent you have. No API keys.
-
Automatic development memory for AI coding agents: turns your Claude Code, Codex, Gemini, Cursor, Copilot, Cline, Devin, OpenCode, Antigravity and Kimi Code sessions into…
-
agent-knowledge io.github.keshrath/agent-knowledge
Cross-session memory for AI agents - knowledge graph, scoring, semantic search
-
MCP server connecting Claude Code to GitHub for an issue to branch to PR to close workflow.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.