oh-my-claudecode
Claude Code native multi-agent orchestration with intelligent model routing across agents and skills. Zero learning curve. Maximum power.
Plugin bundle · by Yeachan Heo
About
oh-my-claudecode is a plugin bundle for AI coding tools published by Yeachan Heo. Marketplaces we read that list it: 1 (Community GitHub marketplaces). We first saw it on 2026-11-11 and have recorded no change since. As of our marketplace pass on 2026-11-11.
What it asks for
- Installs as a plugin bundle
- Hooks: 30
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Works with
- Claude Code
From the marketplaces that list it and the MCP transport it declares, as each client documents them. We do not test plugins.
Connect
Commands and configs built only from what its marketplaces declare. We do not run them for you and do not test plugins.
As a Claude Code plugin
Built from what Community GitHub marketplaces declares.
/plugin marketplace add yeachan-heo/oh-my-claudecode
/plugin install oh-my-claudecode@omcWhere it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Community marketplace yeachan-heo/oh-my-claudecode (Open the source on GitHub) | Listed | 5.8.6 | No figure published | Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
Listed in one community marketplace
| Marketplace | Repository | Stars (GitHub) |
|---|---|---|
| omc | yeachan-heo/oh-my-claudecode | 40 759 |
What the bundle contains
As published on Community GitHub marketplaces.
MCP servers: 1
t
Skills: 84
agent-doc-disciplineai-slop-cleanerarchitectarchitecture-surveyarenaaskask-navigatorautopilotautoresearchbabysitbenchmark-checklistblast-radius
Show the remaining 72
brocancelconfigure-notificationscorrectcreate-formal-verification-skillcreate-verification-skilldebugdeep-interviewdeepinitdiagramdrydockexecuteexternal-contextfigure-it-outfix-cifix-merge-conflictsget-pr-commentsgraphharborhillclimbhowhudin-your-own-wordsintentinterrogateketchupketchup-videolaunchloftmaintain-formal-verification-skillmaintain-verification-skillmapminimal-code-disciplineminimal-prose-disciplinemodelsomc-doctoromc-setuppersonal-modeplanprprinciplesproject-session-managerralphralplanrecallrefitreflectreleaserememberresearchreviewsddself-improvesession-flowsharpenshow-me-your-workskillskillifystacked-deliverystatecharttddteachteamtechnical-writingtracetypescript-best-practicesultragoalverifyvisual-verdictwhat-did-i-get-donewhywiki
Commands: 21
askautoresearchcompactconfigure-notificationsdebugdeepinitexternal-contexthudomc-doctoromc-setupproject-session-managerpsm
Show the remaining 9
releaserememberself-improveskillskillifytraceverifyvisual-verdictwiki
Agents: 19
analystarchitectcode-reviewercode-simplifiercriticdebuggerdesignerdocument-specialistexecutorexploregit-masterplanner
Show the remaining 7
qa-testerscientistsecurity-reviewertest-engineertracerverifierwriter
Hooks: 11
PermissionRequestPostToolUsePostToolUseFailurePreCompactPreToolUseSessionEndSessionStartStopSubagentStartSubagentStopUserPromptSubmit
What changed
- Became a product we track
- Community GitHub marketplaces: appeared
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
Opinionated Claude Code plugin for ultrawork, orchestration guardrails, and review gates.
-
Essential agents and skills for Claude Code workflows - git commits, code simplification, security audits, verified multi-lens code review, thermo-nuclear code-quality review…
-
Transform Claude Code into a structured development platform with 25 commands, 15 specialized agents, 7 behavioral modes, and 8 MCP server integrations
-
Routes Claude Code tasks to focused prompts and adds deterministic documentation, skill, release, safety, and capability-audit workflows.
-
Use Copilot from Claude Code to review code or delegate tasks.
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
23 reusable skills, 2 agents, and smart hooks for any project. Covers the full development cycle: architecture mapping, implementation planning, code review, safe refactoring…
-
Self-improving Claude Code, Codex, and OpenCode plugin that turns corrections and successful workflows into Preferences, Project-specific skills, and Shared skills
-
Grok Build ↔ Claude Code bridge for review, critique, and delegation.
-
Complete collection of agents, skills, hooks, commands, and rules evolved over 10+ months of intensive daily use
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
Engineering management layer for Claude Code --- structures your session like a real dev team where you're PM and Claude is EM. Provides session workflows, multi-persona code…
-
23 reusable skills, 2 agents, and smart hooks for any project. Covers the full development cycle: architecture mapping, implementation planning, code review, safe refactoring…
-
Autonomous PM for Claude Code. Delegate coding tasks to your local Claude Code CLI, iterate with session resumption, keep a running project state without burning orchestrator…
-
Session-level orchestration for Claude Code - structures development work into 5 typed waves (Discovery → Core → Polish → Quality → Finalization) with parallel subagent execution…
-
Guild turns Claude Code into a self-evolving team of specialist agents for larger software tasks. It plans before execution, selects the right specialists, assembles focused…
Has a listing on Claude Code: claude-plugins-official (5)
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Has a listing on Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
gk-cli com.gitkraken/gk-cli
The GitKraken MCP Server for managing repos, PRs, issues across GitHub, GitLab, Bitbucket and more.
-
MCP server for terminal commands, file operations, and process management
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
AI-powered code review in Codex, powered by CodeRabbit.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
Inspect repositories, triage pull requests and issues, debug CI, and publish changes through a hybrid GitHub connector and CLI workflow.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Qodo setup, code intelligence, and review workflows.
Has a listing on Community GitHub marketplaces (5)
-
Opinionated Claude Code plugin for ultrawork, orchestration guardrails, and review gates.
-
Essential agents and skills for Claude Code workflows - git commits, code simplification, security audits, verified multi-lens code review, thermo-nuclear code-quality review…
-
Transform Claude Code into a structured development platform with 25 commands, 15 specialized agents, 7 behavioral modes, and 8 MCP server integrations
-
Routes Claude Code tasks to focused prompts and adds deterministic documentation, skill, release, safety, and capability-audit workflows.
-
Use Copilot from Claude Code to review code or delegate tasks.
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Generic cross-repo command center canvas for GitHub Copilot with onboarding, focus planning, repo health, work signals, and session cleanup.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Model, visualize, and deploy applications with Radius from the GitHub Copilot app and CLI.
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Advanced Security plugin for GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Navigate and interact with your C++ code using the Microsoft C++ Language Server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Has a listing on Cursor: cursor/plugins (5)
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Has a listing on Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
MCP server for terminal commands, file operations, and process management
-
Tools for interacting with the GitHub API, enabling file operations, repository management, search functionality, and more.
Has a listing on Official MCP Registry (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
Gives AI agents the function they asked for, not the file. Commercial use needs a license.
-
Grow your skills with AI: per-skill coaching inside Claude, ChatGPT, Cursor and Codex
-
Search and run hosted AI agent skills for Claude Code, Codex, Cursor and Gemini CLI.
-
consult io.github.neelsatyavolu/consult
Get a second opinion on your code from every coding agent you have. No API keys.
Has a listing on PyPI (MCP servers) (5)
-
Gives AI agents the function they asked for, not the file. Commercial use needs a license.
-
Let one coding-agent CLI consult another: Codex, Claude Code, OpenCode, Copilot or Antigravity.
-
repo-graph io.github.James-Chahwan/repo-graph
Structural graph map of any codebase so LLMs navigate by structure, not guesswork.
-
A code intelligence graph that gives AI coding agents deep, token-efficient understanding of your codebase.
-
Zero-config MCP server for searchable documentation. SQLite or PostgreSQL.
Has a listing on npm registry (MCP servers) (5)
-
PAPI: Persistent Adaptive Project Intelligence
Adaptive plan/build/review cycles for AI coding assistants, persisted across sessions.
-
consult io.github.neelsatyavolu/consult
Get a second opinion on your code from every coding agent you have. No API keys.
-
Automatic development memory for AI coding agents: turns your Claude Code, Codex, Gemini, Cursor, Copilot, Cline, Devin, OpenCode, Antigravity and Kimi Code sessions into…
-
agent-knowledge io.github.keshrath/agent-knowledge
Cross-session memory for AI agents - knowledge graph, scoring, semantic search
-
MCP server connecting Claude Code to GitHub for an issue to branch to PR to close workflow.
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Want this mark on your plugin in our catalog?
Prove you maintain it with a file in its repository, a file on your domain or a DNS record, and you can show this mark on the card, with live banners for your site and README. How verification works
You also get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from public marketplace files in GitHub repositories of their authors. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.