designlang
Measure any site's design system, score how generic a page looks, check UI against your brand.
MCP-Server · von Manavarya09
Überblick
designlang ist ein MCP-Server von Manavarya09. Marktplätze, die wir lesen und die es listen: 2 (Official MCP Registry, Community GitHub marketplaces). Die letzte erfasste Änderung war am 2026-11-11. Stand unseres Marktplatz-Durchlaufs vom 2026-11-11.
Was es abfragt
- Läuft auf Ihrem Rechner
- Geheimnisse: 1
- Einstellungen: 1
Erfordert: DESIGNLANG_BRAND_TOKEN (geheim)
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
- Codex
- Cursor
- VS Code
- Copilot CLI
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als lokaler MCP-Server: npm-Paket
Erstellt aus den Angaben von Official MCP Registry.
claude mcp add --env "DESIGNLANG_BRAND_TOKEN=<YOUR_DESIGNLANG_BRAND_TOKEN>" --transport stdio designlang -- npx -y designlang mcp[mcp_servers.designlang]
command = "npx"
args = ["-y", "designlang", "mcp"]
[mcp_servers.designlang.env]
DESIGNLANG_BRAND_TOKEN = "<YOUR_DESIGNLANG_BRAND_TOKEN>"{
"mcpServers": {
"designlang": {
"command": "npx",
"args": [
"-y",
"designlang",
"mcp"
],
"env": {
"DESIGNLANG_BRAND_TOKEN": "<YOUR_DESIGNLANG_BRAND_TOKEN>"
}
}
}
}Ersetzen Sie die Werte in spitzen Klammern durch Ihre eigenen. Wir zeigen die Namen der Einstellungen, nie Werte.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add manavarya09/design-extract
/plugin install designlang@designlangWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Official MCP Registry (Eintrag in der Registry öffnen) | Gelistet | 13.4.1 | Keine Zahl veröffentlicht | Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
Auch in einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| designlang | manavarya09/design-extract | 5 037 |
Wie sich die Zahlen entwickelt haben
- 2026-10-29376
- 2026-11-01380
- 2026-11-02384
- 2026-11-03385
- 2026-11-05398
- 2026-11-06404
- 2026-11-08407
- 2026-11-09411
- 2026-11-11421
- 2026-10-294,4 Tsd.
- 2026-10-304,4 Tsd.
- 2026-11-014,4 Tsd.
- 2026-11-024,5 Tsd.
- 2026-11-034,5 Tsd.
- 2026-11-054,7 Tsd.
- 2026-11-064,8 Tsd.
- 2026-11-084,9 Tsd.
- 2026-11-095 Tsd.
- 2026-11-115 Tsd.
Jeder Punkt ist ein Tag, an dem wir eine andere Zahl gelesen haben; flache Abschnitte sind Tage ohne Veränderung. Zahlen verschiedener Marktplätze werden nie addiert.
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
Skills: 1
extract-design
Befehle: 14
battlebranddnaextractfidelitygallerygradepackpairremixsitestudio
Weitere anzeigen: 2
theme-swapverify
Was sich geändert hat
- Community GitHub marketplaces: Version 13.4.1 veröffentlicht (vorher 13.4.0)
- Auf einem neuen Marktplatz erschienen: Official MCP Registry
- Sein Haupteintrag hat sich geändert
- Official MCP Registry: erschienen
- Community GitHub marketplaces: Version 13.4.0 veröffentlicht (vorher 13.3.2)
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Audit and improve front-end usability using 15 established design principles. Acts as a Senior UX designer/engineer reviewing your interface end-to-end.
-
Visual UI/UX scanner auditing websites for heuristic compliance.
-
Score a public website 0 to 100 for the design habits that make it look AI-made.
-
Find what to fix on a site, check if changes worked, see how AI reads it. Free audit, no account.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
design-system-analyzer
Analyze any website's UI style using ChromeDevTools to extract precise CSS tokens, animations, and interaction states. Generates comprehensive Design System Prompts from live…
-
Accessibility and UX audit findings, fix prompts and remediation tasks for your websites.
-
Run accessibility, contrast, and design token audits and file QA issues from your AI coding tool.
-
Agents for UI/UX design, accessibility, and user experience optimization
-
Conduct comprehensive design audits analyzing usability heuristics, accessibility compliance, visual consistency, and design system adherence.
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
A full design suite for Claude Code: 58 brand design systems (Stripe, Linear, Vercel, Google, Anthropic and more) + 5 curated skills for UI/UX generation, accessibility auditing…
-
Audits public-facing websites across accessibility, SEO, GEO (AI search readiness), and usability -- evaluates 17 checks, assigns a letter grade, and generates a client-ready PDF…
-
Free AI visibility audit for any website. Discover how ChatGPT, Claude, and Perplexity perceive your brand across 5 dimensions and 30 checks — then get a one-click fix plan…
-
29 specialized design agents as Claude Code commands. Bring expert design knowledge into every coding session - accessibility, motion design, design systems, color theory…
-
design-drift prevents AI agents from drifting away from your design system in real time. Lock any of existing brands design systems and every Write/Edit to a UI file is…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Create distinctive, production-grade frontend interfaces with high design quality. Generates creative, polished code that avoids generic AI aesthetics.
-
Keep your coding agent up to date with the latest web best practices
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
Gelistet auf Claude: knowledge-work-plugins (5)
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Free AI-powered SEO toolkit — audit websites, plan content strategy, optimize pages, generate schema markup, cluster keywords, and track AI visibility. Works with any website or…
-
Keep your coding agent up to date with the latest web best practices
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Build web apps with frontend asset design, browser testing, UI components, payments, and database guidance.
-
Figma workflows for design implementation, Code Connect templates, and design system rule generation.
-
Use MagicPath to find, inspect, install, create, and edit UI components from Codex.
Gelistet auf Community GitHub marketplaces (5)
-
Audit and improve front-end usability using 15 established design principles. Acts as a Senior UX designer/engineer reviewing your interface end-to-end.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
design-system-analyzer
Analyze any website's UI style using ChromeDevTools to extract precise CSS tokens, animations, and interaction states. Generates comprehensive Design System Prompts from live…
-
Agents for UI/UX design, accessibility, and user experience optimization
-
Conduct comprehensive design audits analyzing usability heuristics, accessibility compliance, visual consistency, and design system adherence.
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Give your AI agent 600,000+ real app screens, and the skills to use them. Includes the Mobbin MCP and a skill that redesigns your screen from patterns real apps ship, in your own…
-
Equips AI coding agents with knowledge and tooling for working with UI theme designer, the SAP Design System, and SAP Fiori design tokens.
-
Keep your coding agent up to date with the latest web best practices
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Gets a product's real brand from its website before the agent designs anything for it. It opens the site in the Chrome, Chromium, Edge or Brave you already have and saves the logo…
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
Advanced Security plugin for GitHub Copilot.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Gelistet auf Cursor: cursor/plugins (5)
-
Analyze website traffic, audiences, and competitors.
-
playwright-mcp io.github.microsoft/playwright-mcp
Playwright Tools for MCP
-
Track AI visibility, sentiment, and citations.
-
Generate presentations, documents, and webpages.
-
CLI-backed repo compatibility scans plus agents that audit startup, validation, and docs against reality.
Gelistet auf Docker MCP Catalog (5)
-
playwright-mcp io.github.microsoft/playwright-mcp
Playwright Tools for MCP
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
Generate images, video, and audio with Glif's media-generation agent
-
Model Context Protocol (MCP) server for the Webflow Data API.
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Gelistet auf Official MCP Registry (5)
-
Visual UI/UX scanner auditing websites for heuristic compliance.
-
Score a public website 0 to 100 for the design habits that make it look AI-made.
-
Find what to fix on a site, check if changes worked, see how AI reads it. Free audit, no account.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
Accessibility and UX audit findings, fix prompts and remediation tasks for your websites.
Gelistet auf PyPI (MCP servers) (5)
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
-
96 MCP tools for Google Search Console, Bing, GA4 and CrUX: SEO audits, traffic diagnostics, local crawl evidence, guarded submissions and opt-in bounded native workflows
-
Audit an MCP server and get a scored, actionable quality report in seconds.
-
Google Search Console MCP: search performance analytics, rankings, sitemaps, and indexing health.
-
Google Search Console: SEO audits, performance queries, URL inspection, indexing checks.
Gelistet auf npm registry (MCP servers) (5)
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
Run accessibility, contrast, and design token audits and file QA issues from your AI coding tool.
-
AI visibility in ChatGPT, Gemini, Claude, Perplexity, Copilot & AI Overviews, plus site audits.
-
miromiro app.miromiro/miromiro
Turn any live website into brand colors, fonts, design tokens, SVGs, Lottie and paste-ready code.
-
Make posters, social posts, slides and landing pages with 198 design systems, checks and exports.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Official MCP Registry. Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.