designlang
Measure any site's design system, score how generic a page looks, check UI against your brand.
MCP server · by Manavarya09
About
designlang is an MCP server published by Manavarya09. Marketplaces we read that list it: 2 (Official MCP Registry, Community GitHub marketplaces). The last change we recorded was on 2026-11-11. As of our marketplace pass on 2026-11-11.
What it asks for
- Runs on your machine
- Secrets: 1
- Settings: 1
Requires: DESIGNLANG_BRAND_TOKEN (secret)
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Works with
- Claude Code
- Codex
- Cursor
- VS Code
- Copilot CLI
From the marketplaces that list it and the MCP transport it declares, as each client documents them. We do not test plugins.
Connect
Commands and configs built only from what its marketplaces declare. We do not run them for you and do not test plugins.
As a local MCP server: npm package
Built from what Official MCP Registry declares.
claude mcp add --env "DESIGNLANG_BRAND_TOKEN=<YOUR_DESIGNLANG_BRAND_TOKEN>" --transport stdio designlang -- npx -y designlang mcp[mcp_servers.designlang]
command = "npx"
args = ["-y", "designlang", "mcp"]
[mcp_servers.designlang.env]
DESIGNLANG_BRAND_TOKEN = "<YOUR_DESIGNLANG_BRAND_TOKEN>"{
"mcpServers": {
"designlang": {
"command": "npx",
"args": [
"-y",
"designlang",
"mcp"
],
"env": {
"DESIGNLANG_BRAND_TOKEN": "<YOUR_DESIGNLANG_BRAND_TOKEN>"
}
}
}
}Replace the values in angle brackets with your own. We show the names of the settings, never values.
As a Claude Code plugin
Built from what Community GitHub marketplaces declares.
/plugin marketplace add manavarya09/design-extract
/plugin install designlang@designlangWhere it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Official MCP Registry (Open the registry record) | Listed | 13.4.1 | No figure published | Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
Also listed in one community marketplace
| Marketplace | Repository | Stars (GitHub) |
|---|---|---|
| designlang | manavarya09/design-extract | 5 037 |
How its figures have moved
- 2026-10-29376
- 2026-11-01380
- 2026-11-02384
- 2026-11-03385
- 2026-11-05398
- 2026-11-06404
- 2026-11-08407
- 2026-11-09411
- 2026-11-11421
- 2026-10-294.4k
- 2026-10-304.4k
- 2026-11-014.4k
- 2026-11-024.5k
- 2026-11-034.5k
- 2026-11-054.7k
- 2026-11-064.8k
- 2026-11-084.9k
- 2026-11-095k
- 2026-11-115k
Each dot is a day we read a different number; flat stretches are days the number did not move. Figures of different marketplaces are never added up.
What the bundle contains
As published on Community GitHub marketplaces.
Skills: 1
extract-design
Commands: 14
battlebranddnaextractfidelitygallerygradepackpairremixsitestudio
Show the remaining 2
theme-swapverify
What changed
- Community GitHub marketplaces: released version 13.4.1 (was 13.4.0)
- Appeared on a new marketplace: Official MCP Registry
- Its main listing changed
- Official MCP Registry: appeared
- Community GitHub marketplaces: released version 13.4.0 (was 13.3.2)
- Became a product we track
- Community GitHub marketplaces: appeared
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
Audit and improve front-end usability using 15 established design principles. Acts as a Senior UX designer/engineer reviewing your interface end-to-end.
-
Visual UI/UX scanner auditing websites for heuristic compliance.
-
Score a public website 0 to 100 for the design habits that make it look AI-made.
-
Find what to fix on a site, check if changes worked, see how AI reads it. Free audit, no account.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
design-system-analyzer
Analyze any website's UI style using ChromeDevTools to extract precise CSS tokens, animations, and interaction states. Generates comprehensive Design System Prompts from live…
-
Accessibility and UX audit findings, fix prompts and remediation tasks for your websites.
-
Run accessibility, contrast, and design token audits and file QA issues from your AI coding tool.
-
Agents for UI/UX design, accessibility, and user experience optimization
-
Conduct comprehensive design audits analyzing usability heuristics, accessibility compliance, visual consistency, and design system adherence.
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
A full design suite for Claude Code: 58 brand design systems (Stripe, Linear, Vercel, Google, Anthropic and more) + 5 curated skills for UI/UX generation, accessibility auditing…
-
Audits public-facing websites across accessibility, SEO, GEO (AI search readiness), and usability -- evaluates 17 checks, assigns a letter grade, and generates a client-ready PDF…
-
Free AI visibility audit for any website. Discover how ChatGPT, Claude, and Perplexity perceive your brand across 5 dimensions and 30 checks — then get a one-click fix plan…
-
29 specialized design agents as Claude Code commands. Bring expert design knowledge into every coding session - accessibility, motion design, design systems, color theory…
-
design-drift prevents AI agents from drifting away from your design system in real time. Lock any of existing brands design systems and every Write/Edit to a UI file is…
Has a listing on Claude Code: claude-plugins-official (5)
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Create distinctive, production-grade frontend interfaces with high design quality. Generates creative, polished code that avoids generic AI aesthetics.
-
Keep your coding agent up to date with the latest web best practices
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
Has a listing on Claude: knowledge-work-plugins (5)
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Free AI-powered SEO toolkit — audit websites, plan content strategy, optimize pages, generate schema markup, cluster keywords, and track AI visibility. Works with any website or…
-
Keep your coding agent up to date with the latest web best practices
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Build web apps with frontend asset design, browser testing, UI components, payments, and database guidance.
-
Figma workflows for design implementation, Code Connect templates, and design system rule generation.
-
Use MagicPath to find, inspect, install, create, and edit UI components from Codex.
Has a listing on Community GitHub marketplaces (5)
-
Audit and improve front-end usability using 15 established design principles. Acts as a Senior UX designer/engineer reviewing your interface end-to-end.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
design-system-analyzer
Analyze any website's UI style using ChromeDevTools to extract precise CSS tokens, animations, and interaction states. Generates comprehensive Design System Prompts from live…
-
Agents for UI/UX design, accessibility, and user experience optimization
-
Conduct comprehensive design audits analyzing usability heuristics, accessibility compliance, visual consistency, and design system adherence.
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Give your AI agent 600,000+ real app screens, and the skills to use them. Includes the Mobbin MCP and a skill that redesigns your screen from patterns real apps ship, in your own…
-
Equips AI coding agents with knowledge and tooling for working with UI theme designer, the SAP Design System, and SAP Fiori design tokens.
-
Keep your coding agent up to date with the latest web best practices
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Gets a product's real brand from its website before the agent designs anything for it. It opens the site in the Chrome, Chromium, Edge or Brave you already have and saves the logo…
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
Advanced Security plugin for GitHub Copilot.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
Has a listing on Cursor: cursor/plugins (5)
-
Analyze website traffic, audiences, and competitors.
-
playwright-mcp io.github.microsoft/playwright-mcp
Playwright Tools for MCP
-
Track AI visibility, sentiment, and citations.
-
Generate presentations, documents, and webpages.
-
CLI-backed repo compatibility scans plus agents that audit startup, validation, and docs against reality.
Has a listing on Docker MCP Catalog (5)
-
playwright-mcp io.github.microsoft/playwright-mcp
Playwright Tools for MCP
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
Generate images, video, and audio with Glif's media-generation agent
-
Model Context Protocol (MCP) server for the Webflow Data API.
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
Has a listing on Official MCP Registry (5)
-
Visual UI/UX scanner auditing websites for heuristic compliance.
-
Score a public website 0 to 100 for the design habits that make it look AI-made.
-
Find what to fix on a site, check if changes worked, see how AI reads it. Free audit, no account.
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
Accessibility and UX audit findings, fix prompts and remediation tasks for your websites.
Has a listing on PyPI (MCP servers) (5)
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
-
96 MCP tools for Google Search Console, Bing, GA4 and CrUX: SEO audits, traffic diagnostics, local crawl evidence, guarded submissions and opt-in bounded native workflows
-
Audit an MCP server and get a scored, actionable quality report in seconds.
-
Google Search Console MCP: search performance analytics, rankings, sitemaps, and indexing health.
-
Google Search Console: SEO audits, performance queries, URL inspection, indexing checks.
Has a listing on npm registry (MCP servers) (5)
-
Audit your Design System and serve your Agent the rules that keep AI-written UI on-system.
-
Run accessibility, contrast, and design token audits and file QA issues from your AI coding tool.
-
AI visibility in ChatGPT, Gemini, Claude, Perplexity, Copilot & AI Overviews, plus site audits.
-
miromiro app.miromiro/miromiro
Turn any live website into brand colors, fonts, design tokens, SVGs, Lottie and paste-ready code.
-
Make posters, social posts, slides and landing pages with 198 design systems, checks and exports.
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Want this mark on your plugin in our catalog?
Prove you maintain it with a file in its repository, a file on your domain or a DNS record, and you can show this mark on the card, with live banners for your site and README. How verification works
You also get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from the Official MCP Registry (registry.modelcontextprotocol.io), CC0 1.0. Data comes from public marketplace files in GitHub repositories of their authors. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.