minimalist-entrepreneur
Claude Code skills based on The Minimalist Entrepreneur by Sahil Lavingia. Frameworks for building a profitable, sustainable business starting from community.
Пакет плагинов · от Sahil Lavingia
Коротко
minimalist-entrepreneur: пакет плагинов для ИИ-инструментов разработки, издатель Sahil Lavingia. Витрин, которые мы читаем и где он опубликован: 1 (Community GitHub marketplaces). Последнее изменение мы зафиксировали 2026-11-10. Данные нашего прохода по витринам на 2026-11-11.
Что просит
- Ставится как пакет плагинов
Ни одна из витрин, которые мы читаем, не публикует его инструменты или настройки, которые он просит.
Что объявляет, просит и запускает, полностью
Устанавливайте плагины только от разработчиков, которым доверяете. Мы показываем то, что публикуют витрины, и не проверяем плагины.
Работает с
- Claude Code
По маркетплейсам, где он опубликован, и объявленному транспорту MCP, как их документирует каждый клиент. Плагины мы не тестируем.
Подключить
Команды и конфигурации собраны только из того, что объявляют витрины. Мы не запускаем их за вас и не проверяем плагины.
Как плагин Claude Code
Собрано из того, что объявляет Community GitHub marketplaces.
/plugin marketplace add slavingia/skills
/plugin install minimalist-entrepreneur@minimalist-entrepreneurГде опубликован
| Витрина | Статус | Версия | Числа | Проверен | Впервые замечен |
|---|---|---|---|---|---|
| Маркетплейс сообщества slavingia/skills (Открыть исходники на GitHub) | Опубликован | 1.0.0 | Форки (GitHub): 1 123 Звёзды (GitHub): 11 158 |
Не помечен |
Каждое число принадлежит своей витрине и никогда не складывается с числами других витрин. Если витрина число не публикует, мы его не показываем: нет числа не значит ноль.
Есть в одном маркетплейсе сообщества
| Витрина | Репозиторий | Звёзды (GitHub) |
|---|---|---|
| minimalist-entrepreneur | slavingia/skills | 11 158 |
Как менялись числа
- 2026-11-071,1 тыс.
- 2026-11-091,1 тыс.
- 2026-11-101,1 тыс.
- 2026-11-0711,1 тыс.
- 2026-11-0911,2 тыс.
- 2026-11-1011,2 тыс.
Каждая точка: день, когда мы прочитали другое число; ровные участки: дни, когда число не менялось. Числа разных витрин никогда не складываются.
Что входит в пакет
Так опубликовано на витрине Community GitHub marketplaces.
Скиллы: 10
company-valuesfind-communityfirst-customersgrow-sustainablymarketing-planminimalist-reviewmvppricingprocessizevalidate-idea
Что менялось
- Стал продуктом, за которым мы следим
- Community GitHub marketplaces: появился
Похожие плагины
Продукты, чьи собственные названия, описания, инструменты и скиллы ближе всего по смыслу к этому, на всех витринах, которые мы читаем. Близость упорядочена только внутри этого списка.
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
-
Founder & startup skills: Startup Idea Validator, Fundraising FAQ, Cap Table Explainer, Founder-Market Fit, Investor Cold Email, Runway Planner. Pressure-test an idea, prep for…
-
Essential skills for founders: SOPs, conversion optimization, viral hooks, lead magnets, social media writing, outreach, and strategic planning
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
Похожие плагины по витринам
Тот же вопрос к каждой витрине по отдельности: есть ли там аналог этого плагина?
Есть на витрине Claude Code: claude-plugins-community (5)
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Executive intelligence layer for solo founders — adversarial plan review, structured market research, and professional external-facing document production across an AI-powered…
-
Run a product initiative as a tracked journey — not a toolbox of one-shot answers. Persistent state across sessions: living PRD, evidence-typed hypotheses…
-
AI Product Discovery skills for Claude Code, powered by ClosedLoop AI. Deep-dive into any topic against all your product insights — every customer quote, pain point, business…
-
Product management skills for Claude Code. Gives Claude structured methodologies for discovery synthesis (JTBD, empathy mapping, journey mapping), user research design (interview…
Есть на витрине Claude Code: claude-plugins-official (5)
-
Analyze business data and build custom Pigment models, metrics, and boards through natural language.
-
Government contracting research and capture workflows in Claude: opportunity and pipeline briefs, bid/no-bid and competitor analysis, price-to-win and proposal prep, powered by…
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
QuickBooks business insights and actions: financial health briefings across P&L, cash flow, balance sheet and A/R, industry benchmarking, payroll cost analysis, overdue-invoice…
Есть на витрине Claude: knowledge-work-plugins (5)
-
Write feature specs, plan roadmaps, and synthesize user research faster. Keep stakeholders updated and stay ahead of the competitive landscape.
-
Pre-built small business workflows to help you run and grow your business. Supports a majority of the tools you already use. You approve every step that touches money or…
-
Create content, plan campaigns, and analyze performance across marketing channels. Maintain brand voice consistency, track competitors, and report on what's working.
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
AI agent skills that make SaaS products data-ready for product analytics — from codebase scan to tracking plan to working instrumentation code.
Есть на витрине Codex: openai-curated (openai/plugins) (5)
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
-
Shopify for ChatGPT makes store building and management as easy as having a conversation. Effortlessly connect your existing store or create a new online store by describing your…
-
Notion workflows for implementation planning, research synthesis, meeting preparation, and knowledge capture.
-
Develop your payments integration faster with the ability to create products, prices, and payment links directly in ChatGPT. Run your business from ChatGPT with the ability to…
Есть на витрине Community GitHub marketplaces (3)
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
Есть на витрине Copilot CLI: github/awesome-copilot (5)
-
MCP server and 12 skills for product analysis, specification writing, strategy, narrative, and stakeholder alignment. Run competitive analyses, write zero-question specs, design…
-
Before your agent signs up for a paid API, LLM model, cloud service, SaaS plan, domain or anything else that costs money, it checks free tiers, right-sized plans and billing…
-
Turn your Copilot sessions into proof of impact — research-grounded HTML reports with effort estimation, skills analysis, and ROI metrics from local session logs.
-
Makes a 20 to 40 second launch film for a product from its website or App Store page: an MP4 at 1920x1080 with music, using the product's real logo, colors, fonts and screens…
-
Explore grouped customer feedback signals by impact and drill into a theme to guide product next steps.
Есть на витрине Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
workiq-productivity
WorkIQ productivity skills powered by the local WorkIQ CLI — read-only insights across email, meetings, calendar, Teams, SharePoint, projects, and people.
-
workiq
Query Microsoft 365 data with natural language — emails, meetings, documents, Teams messages, and more.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Есть на витрине Cursor: cursor/plugins (5)
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Generate presentations, documents, and webpages.
-
Search company knowledge and draft verified answers.
-
Research private companies, deals, investors, and funds.
-
Run your beehiiv newsletter from chat: draft and edit posts, organize subscribers with tags, custom fields, and segments, build automations, and review publication, post, and…
Есть на витрине Docker MCP Catalog (5)
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
AI assistant for ingested content with anonymous access.
-
Production-ready RAG service to search and retrieve data from your documents.
-
Generate images, video, and audio with Glif's media-generation agent
-
A Model Context Protocol (MCP) server for querying deals and evaluations from the Opine CRM API.
Есть на витрине Official MCP Registry (5)
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
-
ideation ai.actwise/ideation
Actwise Ideation helps founders benchmark startup and product ideas before they build.
-
Validate startup ideas with real people asking for them, each quote linked to its source.
-
public ai.colaunched/public
Business ideas from real public demand, scored with dated evidence. No account needed.
Есть на витрине PyPI (MCP servers) (5)
-
Connect AI assistants to Outline for document search, reading, and management
-
Verifies news stories, mines SEO keywords, builds schema and reviews your draft. You write it.
-
AI-powered PowerPoint (.pptx) generation, editing, and review via MCP — 43 tools, 53 slide types, 12 chart types, 8 diagrams, 12 branded presets, 34 archetypes, 8 variant groups…
-
Account-bound, typed and durable stdio MCP gateway for the Kwork freelance marketplace
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
Есть на витрине npm registry (MCP servers) (5)
-
MCP server for IdeaRoast: free startup idea gut check plus a paid 4-agent due diligence panel (market, tech, finance, timing)
-
Revenue intelligence for complex B2B growth.
-
AI marketing agent and AI ad generator: 1199 tools, usable alone. No model markup on Starter and up.
-
Clien.ai MCP server — deep product research from Claude Code.
-
Build and manage GrowSurf referral and affiliate programs through AI assistants.
Найдено по смыслу, а не по общему коду или репозиторию: похожие плагины остаются разными продуктами, и это не обзор и не рекомендация.
Хотите такой знак у своего плагина в нашем каталоге?
Докажите, что поддерживаете его, файлом в репозитории, файлом на вашем домене или DNS-записью, и сможете показать этот знак на карточке, а ещё живые баннеры для сайта и README. Как проходит подтверждение
Ещё вы будете получать уведомления, когда витрина добавит плагин, снимет его, изменит отметку verified или список того, что он просит, а его удалённый endpoint встанет на мониторинг как веб-сервис.
Данные витрины Community GitHub marketplaces. Числа взяты из наших регулярных обходов витрин, последняя проверка . Контакты издателей плагинов мы не публикуем.