minimalist-entrepreneur
Claude Code skills based on The Minimalist Entrepreneur by Sahil Lavingia. Frameworks for building a profitable, sustainable business starting from community.
Paquete de plugins · de Sahil Lavingia
Resumen
minimalist-entrepreneur es un paquete de plugins para herramientas de programación con IA publicado por Sahil Lavingia. Marketplaces que leemos y que lo publican: 1 (Community GitHub marketplaces). El último cambio que registramos fue el 2026-11-10. Según nuestra pasada por los marketplaces del 2026-11-11.
Qué pide
- Se instala como paquete de plugins
Ninguno de los marketplaces que leemos publica sus herramientas ni los ajustes que pide.
Lo que declara, pide y ejecuta, completo
Instala solo plugins de desarrolladores en los que confíes. Mostramos lo que publican los marketplaces y no probamos plugins.
Funciona con
- Claude Code
Según los marketplaces que lo listan y el transporte MCP que declara, tal como lo documenta cada cliente. No probamos plugins.
Conectar
Comandos y configuraciones generados solo a partir de lo que declaran sus marketplaces. No los ejecutamos por ti ni probamos plugins.
Como plugin de Claude Code
Generado a partir de lo que declara Community GitHub marketplaces.
/plugin marketplace add slavingia/skills
/plugin install minimalist-entrepreneur@minimalist-entrepreneurDónde está publicado
| Marketplace | Estado | Versión | Cifras | Verificado | Visto por primera vez |
|---|---|---|---|---|---|
| Marketplace de la comunidad slavingia/skills (Abrir el código en GitHub) | Publicado | 1.0.0 | Forks (GitHub): 1 123 Estrellas (GitHub): 11 158 |
Sin marca |
Cada cifra es del propio marketplace y nunca se suma entre marketplaces. Un marketplace que no publica cifras no muestra ninguna: sin número no es cero.
Figura en un marketplace de la comunidad
| Marketplace | Repositorio | Estrellas (GitHub) |
|---|---|---|
| minimalist-entrepreneur | slavingia/skills | 11 158 |
Cómo han cambiado sus cifras
- 2026-11-071,1 mil
- 2026-11-091,1 mil
- 2026-11-101,1 mil
- 2026-11-0711,1 mil
- 2026-11-0911,2 mil
- 2026-11-1011,2 mil
Cada punto es un día en que leímos un número distinto; los tramos planos son días en que el número no cambió. Las cifras de distintos marketplaces nunca se suman.
Qué contiene el paquete
Tal como se publica en Community GitHub marketplaces.
Skills: 10
company-valuesfind-communityfirst-customersgrow-sustainablymarketing-planminimalist-reviewmvppricingprocessizevalidate-idea
Qué cambió
- Pasó a ser un producto que seguimos
- Community GitHub marketplaces: apareció
Plugins similares
Productos cuyos propios nombres, descripciones, herramientas y skills son los más cercanos a este por su significado, en todos los marketplaces que leemos. La cercanía se ordena solo dentro de esta lista.
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
-
Founder & startup skills: Startup Idea Validator, Fundraising FAQ, Cap Table Explainer, Founder-Market Fit, Investor Cold Email, Runway Planner. Pressure-test an idea, prep for…
-
Essential skills for founders: SOPs, conversion optimization, viral hooks, lead magnets, social media writing, outreach, and strategic planning
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
Plugins similares por marketplace
La misma pregunta a cada marketplace por separado: ¿hay allí un equivalente de este plugin?
Publicado en Claude Code: claude-plugins-community (5)
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Executive intelligence layer for solo founders — adversarial plan review, structured market research, and professional external-facing document production across an AI-powered…
-
Run a product initiative as a tracked journey — not a toolbox of one-shot answers. Persistent state across sessions: living PRD, evidence-typed hypotheses…
-
AI Product Discovery skills for Claude Code, powered by ClosedLoop AI. Deep-dive into any topic against all your product insights — every customer quote, pain point, business…
-
Product management skills for Claude Code. Gives Claude structured methodologies for discovery synthesis (JTBD, empathy mapping, journey mapping), user research design (interview…
Publicado en Claude Code: claude-plugins-official (5)
-
Analyze business data and build custom Pigment models, metrics, and boards through natural language.
-
Government contracting research and capture workflows in Claude: opportunity and pipeline briefs, bid/no-bid and competitor analysis, price-to-win and proposal prep, powered by…
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
QuickBooks business insights and actions: financial health briefings across P&L, cash flow, balance sheet and A/R, industry benchmarking, payroll cost analysis, overdue-invoice…
Publicado en Claude: knowledge-work-plugins (5)
-
Write feature specs, plan roadmaps, and synthesize user research faster. Keep stakeholders updated and stay ahead of the competitive landscape.
-
Pre-built small business workflows to help you run and grow your business. Supports a majority of the tools you already use. You approve every step that touches money or…
-
Create content, plan campaigns, and analyze performance across marketing channels. Maintain brand voice consistency, track competitors, and report on what's working.
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
AI agent skills that make SaaS products data-ready for product analytics — from codebase scan to tracking plan to working instrumentation code.
Publicado en Codex: openai-curated (openai/plugins) (5)
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
-
Shopify for ChatGPT makes store building and management as easy as having a conversation. Effortlessly connect your existing store or create a new online store by describing your…
-
Notion workflows for implementation planning, research synthesis, meeting preparation, and knowledge capture.
-
Develop your payments integration faster with the ability to create products, prices, and payment links directly in ChatGPT. Run your business from ChatGPT with the ability to…
Publicado en Community GitHub marketplaces (3)
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
Publicado en Copilot CLI: github/awesome-copilot (5)
-
MCP server and 12 skills for product analysis, specification writing, strategy, narrative, and stakeholder alignment. Run competitive analyses, write zero-question specs, design…
-
Before your agent signs up for a paid API, LLM model, cloud service, SaaS plan, domain or anything else that costs money, it checks free tiers, right-sized plans and billing…
-
Turn your Copilot sessions into proof of impact — research-grounded HTML reports with effort estimation, skills analysis, and ROI metrics from local session logs.
-
Makes a 20 to 40 second launch film for a product from its website or App Store page: an MP4 at 1920x1080 with music, using the product's real logo, colors, fonts and screens…
-
Explore grouped customer feedback signals by impact and drill into a theme to guide product next steps.
Publicado en Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
workiq-productivity
WorkIQ productivity skills powered by the local WorkIQ CLI — read-only insights across email, meetings, calendar, Teams, SharePoint, projects, and people.
-
workiq
Query Microsoft 365 data with natural language — emails, meetings, documents, Teams messages, and more.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Publicado en Cursor: cursor/plugins (5)
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Generate presentations, documents, and webpages.
-
Search company knowledge and draft verified answers.
-
Research private companies, deals, investors, and funds.
-
Run your beehiiv newsletter from chat: draft and edit posts, organize subscribers with tags, custom fields, and segments, build automations, and review publication, post, and…
Publicado en Docker MCP Catalog (5)
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
AI assistant for ingested content with anonymous access.
-
Production-ready RAG service to search and retrieve data from your documents.
-
Generate images, video, and audio with Glif's media-generation agent
-
A Model Context Protocol (MCP) server for querying deals and evaluations from the Opine CRM API.
Publicado en Official MCP Registry (5)
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
-
ideation ai.actwise/ideation
Actwise Ideation helps founders benchmark startup and product ideas before they build.
-
Validate startup ideas with real people asking for them, each quote linked to its source.
-
public ai.colaunched/public
Business ideas from real public demand, scored with dated evidence. No account needed.
Publicado en PyPI (MCP servers) (5)
-
Connect AI assistants to Outline for document search, reading, and management
-
Verifies news stories, mines SEO keywords, builds schema and reviews your draft. You write it.
-
AI-powered PowerPoint (.pptx) generation, editing, and review via MCP — 43 tools, 53 slide types, 12 chart types, 8 diagrams, 12 branded presets, 34 archetypes, 8 variant groups…
-
Account-bound, typed and durable stdio MCP gateway for the Kwork freelance marketplace
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
Publicado en npm registry (MCP servers) (5)
-
MCP server for IdeaRoast: free startup idea gut check plus a paid 4-agent due diligence panel (market, tech, finance, timing)
-
Revenue intelligence for complex B2B growth.
-
AI marketing agent and AI ad generator: 1199 tools, usable alone. No model markup on Starter and up.
-
Clien.ai MCP server — deep product research from Claude Code.
-
Build and manage GrowSurf referral and affiliate programs through AI assistants.
Encontrados por significado, no por código ni repositorio compartidos: los plugins similares siguen siendo productos distintos, y esto no es una reseña ni una recomendación.
¿Quieres esta marca para tu plugin en nuestro catálogo?
Demuestra que lo mantienes con un archivo en su repositorio, un archivo en tu dominio o un registro DNS, y podrás mostrar esta marca en la ficha, con banners en vivo para tu web y tu README. Cómo funciona la verificación
Además recibirás avisos cuando un marketplace lo publique, lo retire, cambie su marca verificada o lo que pide, y su endpoint remoto quedará monitorizado como un servicio web.
Datos de Community GitHub marketplaces. Las cifras proceden de nuestros propios recorridos periódicos por los marketplaces, leída por última vez el . No publicamos datos de contacto de los editores de plugins.