minimalist-entrepreneur
Claude Code skills based on The Minimalist Entrepreneur by Sahil Lavingia. Frameworks for building a profitable, sustainable business starting from community.
Plugin-Paket · von Sahil Lavingia
Überblick
minimalist-entrepreneur ist ein Plugin-Paket für KI-Coding-Tools von Sahil Lavingia. Marktplätze, die wir lesen und die es listen: 1 (Community GitHub marketplaces). Die letzte erfasste Änderung war am 2026-11-10. Stand unseres Marktplatz-Durchlaufs vom 2026-11-11.
Was es abfragt
- Wird als Plugin-Paket installiert
Keiner der Marktplätze, die wir lesen, veröffentlicht seine Tools oder die abgefragten Einstellungen.
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add slavingia/skills
/plugin install minimalist-entrepreneur@minimalist-entrepreneurWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz slavingia/skills (Quelle auf GitHub öffnen) | Gelistet | 1.0.0 | Forks (GitHub): 1 123 Sterne (GitHub): 11 158 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
In einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| minimalist-entrepreneur | slavingia/skills | 11 158 |
Wie sich die Zahlen entwickelt haben
- 2026-11-071,1 Tsd.
- 2026-11-091,1 Tsd.
- 2026-11-101,1 Tsd.
- 2026-11-0711,1 Tsd.
- 2026-11-0911,2 Tsd.
- 2026-11-1011,2 Tsd.
Jeder Punkt ist ein Tag, an dem wir eine andere Zahl gelesen haben; flache Abschnitte sind Tage ohne Veränderung. Zahlen verschiedener Marktplätze werden nie addiert.
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
Skills: 10
company-valuesfind-communityfirst-customersgrow-sustainablymarketing-planminimalist-reviewmvppricingprocessizevalidate-idea
Was sich geändert hat
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
-
Founder & startup skills: Startup Idea Validator, Fundraising FAQ, Cap Table Explainer, Founder-Market Fit, Investor Cold Email, Runway Planner. Pressure-test an idea, prep for…
-
Essential skills for founders: SOPs, conversion optimization, viral hooks, lead magnets, social media writing, outreach, and strategic planning
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Executive intelligence layer for solo founders — adversarial plan review, structured market research, and professional external-facing document production across an AI-powered…
-
Run a product initiative as a tracked journey — not a toolbox of one-shot answers. Persistent state across sessions: living PRD, evidence-typed hypotheses…
-
AI Product Discovery skills for Claude Code, powered by ClosedLoop AI. Deep-dive into any topic against all your product insights — every customer quote, pain point, business…
-
Product management skills for Claude Code. Gives Claude structured methodologies for discovery synthesis (JTBD, empathy mapping, journey mapping), user research design (interview…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Analyze business data and build custom Pigment models, metrics, and boards through natural language.
-
Government contracting research and capture workflows in Claude: opportunity and pipeline briefs, bid/no-bid and competitor analysis, price-to-win and proposal prep, powered by…
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
QuickBooks business insights and actions: financial health briefings across P&L, cash flow, balance sheet and A/R, industry benchmarking, payroll cost analysis, overdue-invoice…
Gelistet auf Claude: knowledge-work-plugins (5)
-
Write feature specs, plan roadmaps, and synthesize user research faster. Keep stakeholders updated and stay ahead of the competitive landscape.
-
Pre-built small business workflows to help you run and grow your business. Supports a majority of the tools you already use. You approve every step that touches money or…
-
Create content, plan campaigns, and analyze performance across marketing channels. Maintain brand voice consistency, track competitors, and report on what's working.
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
AI agent skills that make SaaS products data-ready for product analytics — from codebase scan to tracking plan to working instrumentation code.
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
-
Shopify for ChatGPT makes store building and management as easy as having a conversation. Effortlessly connect your existing store or create a new online store by describing your…
-
Notion workflows for implementation planning, research synthesis, meeting preparation, and knowledge capture.
-
Develop your payments integration faster with the ability to create products, prices, and payment links directly in ChatGPT. Run your business from ChatGPT with the ability to…
Gelistet auf Community GitHub marketplaces (3)
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
MCP server and 12 skills for product analysis, specification writing, strategy, narrative, and stakeholder alignment. Run competitive analyses, write zero-question specs, design…
-
Before your agent signs up for a paid API, LLM model, cloud service, SaaS plan, domain or anything else that costs money, it checks free tiers, right-sized plans and billing…
-
Turn your Copilot sessions into proof of impact — research-grounded HTML reports with effort estimation, skills analysis, and ROI metrics from local session logs.
-
Makes a 20 to 40 second launch film for a product from its website or App Store page: an MP4 at 1920x1080 with music, using the product's real logo, colors, fonts and screens…
-
Explore grouped customer feedback signals by impact and drill into a theme to guide product next steps.
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
workiq-productivity
WorkIQ productivity skills powered by the local WorkIQ CLI — read-only insights across email, meetings, calendar, Teams, SharePoint, projects, and people.
-
workiq
Query Microsoft 365 data with natural language — emails, meetings, documents, Teams messages, and more.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Gelistet auf Cursor: cursor/plugins (5)
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Generate presentations, documents, and webpages.
-
Search company knowledge and draft verified answers.
-
Research private companies, deals, investors, and funds.
-
Run your beehiiv newsletter from chat: draft and edit posts, organize subscribers with tags, custom fields, and segments, build automations, and review publication, post, and…
Gelistet auf Docker MCP Catalog (5)
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
AI assistant for ingested content with anonymous access.
-
Production-ready RAG service to search and retrieve data from your documents.
-
Generate images, video, and audio with Glif's media-generation agent
-
A Model Context Protocol (MCP) server for querying deals and evaluations from the Opine CRM API.
Gelistet auf Official MCP Registry (5)
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
-
ideation ai.actwise/ideation
Actwise Ideation helps founders benchmark startup and product ideas before they build.
-
Validate startup ideas with real people asking for them, each quote linked to its source.
-
public ai.colaunched/public
Business ideas from real public demand, scored with dated evidence. No account needed.
Gelistet auf PyPI (MCP servers) (5)
-
Connect AI assistants to Outline for document search, reading, and management
-
Verifies news stories, mines SEO keywords, builds schema and reviews your draft. You write it.
-
AI-powered PowerPoint (.pptx) generation, editing, and review via MCP — 43 tools, 53 slide types, 12 chart types, 8 diagrams, 12 branded presets, 34 archetypes, 8 variant groups…
-
Account-bound, typed and durable stdio MCP gateway for the Kwork freelance marketplace
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
Gelistet auf npm registry (MCP servers) (5)
-
MCP server for IdeaRoast: free startup idea gut check plus a paid 4-agent due diligence panel (market, tech, finance, timing)
-
Revenue intelligence for complex B2B growth.
-
AI marketing agent and AI ad generator: 1199 tools, usable alone. No model markup on Starter and up.
-
Clien.ai MCP server — deep product research from Claude Code.
-
Build and manage GrowSurf referral and affiliate programs through AI assistants.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.