minimalist-entrepreneur
Claude Code skills based on The Minimalist Entrepreneur by Sahil Lavingia. Frameworks for building a profitable, sustainable business starting from community.
Pacote de plugins · de Sahil Lavingia
Resumo
minimalist-entrepreneur é um pacote de plugins para ferramentas de programação com IA publicado por Sahil Lavingia. Marketplaces que lemos e que o listam: 1 (Community GitHub marketplaces). A última mudança que registramos foi em 2026-11-10. Conforme nossa passagem pelos marketplaces em 2026-11-11.
O que pede
- Instala-se como pacote de plugins
Nenhum dos marketplaces que lemos publica as ferramentas ou as configurações que ele pede.
O que declara, pede e executa, por completo
Instale apenas plugins de desenvolvedores em quem você confia. Mostramos o que os marketplaces publicam e não testamos plugins.
Funciona com
- Claude Code
Pelos marketplaces que o listam e pelo transporte MCP que declara, conforme cada cliente documenta. Não testamos plugins.
Conectar
Comandos e configurações gerados apenas a partir do que os marketplaces declaram. Não os executamos por você e não testamos plugins.
Como plugin do Claude Code
Gerado a partir do que Community GitHub marketplaces declara.
/plugin marketplace add slavingia/skills
/plugin install minimalist-entrepreneur@minimalist-entrepreneurOnde está publicado
| Marketplace | Status | Versão | Números | Verificado | Visto pela primeira vez |
|---|---|---|---|---|---|
| Marketplace da comunidade slavingia/skills (Abrir o código no GitHub) | Listado | 1.0.0 | Forks (GitHub): 1 123 Estrelas (GitHub): 11 158 |
Sem marcação |
Cada número é do próprio marketplace e nunca é somado entre marketplaces. Um marketplace que não publica números não mostra nenhum: sem número não é zero.
Listado em um marketplace da comunidade
| Marketplace | Repositório | Estrelas (GitHub) |
|---|---|---|
| minimalist-entrepreneur | slavingia/skills | 11 158 |
Como os números mudaram
- 2026-11-071,1 mil
- 2026-11-091,1 mil
- 2026-11-101,1 mil
- 2026-11-0711,1 mil
- 2026-11-0911,2 mil
- 2026-11-1011,2 mil
Cada ponto é um dia em que lemos um número diferente; os trechos planos são dias em que o número não mudou. Números de marketplaces diferentes nunca são somados.
O que o pacote contém
Conforme publicado em Community GitHub marketplaces.
Skills: 10
company-valuesfind-communityfirst-customersgrow-sustainablymarketing-planminimalist-reviewmvppricingprocessizevalidate-idea
O que mudou
- Passou a ser um produto que acompanhamos
- Community GitHub marketplaces: apareceu
Plugins semelhantes
Produtos cujos próprios nomes, descrições, ferramentas e skills são os mais próximos deste pelo significado, em todos os marketplaces que lemos. A proximidade é ordenada apenas dentro desta lista.
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
-
Founder & startup skills: Startup Idea Validator, Fundraising FAQ, Cap Table Explainer, Founder-Market Fit, Investor Cold Email, Runway Planner. Pressure-test an idea, prep for…
-
Essential skills for founders: SOPs, conversion optimization, viral hooks, lead magnets, social media writing, outreach, and strategic planning
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
Plugins semelhantes por marketplace
A mesma pergunta feita a cada marketplace separadamente: existe lá um equivalente deste plugin?
Listado em Claude Code: claude-plugins-community (5)
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Executive intelligence layer for solo founders — adversarial plan review, structured market research, and professional external-facing document production across an AI-powered…
-
Run a product initiative as a tracked journey — not a toolbox of one-shot answers. Persistent state across sessions: living PRD, evidence-typed hypotheses…
-
AI Product Discovery skills for Claude Code, powered by ClosedLoop AI. Deep-dive into any topic against all your product insights — every customer quote, pain point, business…
-
Product management skills for Claude Code. Gives Claude structured methodologies for discovery synthesis (JTBD, empathy mapping, journey mapping), user research design (interview…
Listado em Claude Code: claude-plugins-official (5)
-
Analyze business data and build custom Pigment models, metrics, and boards through natural language.
-
Government contracting research and capture workflows in Claude: opportunity and pipeline briefs, bid/no-bid and competitor analysis, price-to-win and proposal prep, powered by…
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
QuickBooks business insights and actions: financial health briefings across P&L, cash flow, balance sheet and A/R, industry benchmarking, payroll cost analysis, overdue-invoice…
Listado em Claude: knowledge-work-plugins (5)
-
Write feature specs, plan roadmaps, and synthesize user research faster. Keep stakeholders updated and stay ahead of the competitive landscape.
-
Pre-built small business workflows to help you run and grow your business. Supports a majority of the tools you already use. You approve every step that touches money or…
-
Create content, plan campaigns, and analyze performance across marketing channels. Maintain brand voice consistency, track competitors, and report on what's working.
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
AI agent skills that make SaaS products data-ready for product analytics — from codebase scan to tracking plan to working instrumentation code.
Listado em Codex: openai-curated (openai/plugins) (5)
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
-
Shopify for ChatGPT makes store building and management as easy as having a conversation. Effortlessly connect your existing store or create a new online store by describing your…
-
Notion workflows for implementation planning, research synthesis, meeting preparation, and knowledge capture.
-
Develop your payments integration faster with the ability to create products, prices, and payment links directly in ChatGPT. Run your business from ChatGPT with the ability to…
Listado em Community GitHub marketplaces (3)
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
Listado em Copilot CLI: github/awesome-copilot (5)
-
MCP server and 12 skills for product analysis, specification writing, strategy, narrative, and stakeholder alignment. Run competitive analyses, write zero-question specs, design…
-
Before your agent signs up for a paid API, LLM model, cloud service, SaaS plan, domain or anything else that costs money, it checks free tiers, right-sized plans and billing…
-
Turn your Copilot sessions into proof of impact — research-grounded HTML reports with effort estimation, skills analysis, and ROI metrics from local session logs.
-
Makes a 20 to 40 second launch film for a product from its website or App Store page: an MP4 at 1920x1080 with music, using the product's real logo, colors, fonts and screens…
-
Explore grouped customer feedback signals by impact and drill into a theme to guide product next steps.
Listado em Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
workiq-productivity
WorkIQ productivity skills powered by the local WorkIQ CLI — read-only insights across email, meetings, calendar, Teams, SharePoint, projects, and people.
-
workiq
Query Microsoft 365 data with natural language — emails, meetings, documents, Teams messages, and more.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Listado em Cursor: cursor/plugins (5)
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Generate presentations, documents, and webpages.
-
Search company knowledge and draft verified answers.
-
Research private companies, deals, investors, and funds.
-
Run your beehiiv newsletter from chat: draft and edit posts, organize subscribers with tags, custom fields, and segments, build automations, and review publication, post, and…
Listado em Docker MCP Catalog (5)
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
AI assistant for ingested content with anonymous access.
-
Production-ready RAG service to search and retrieve data from your documents.
-
Generate images, video, and audio with Glif's media-generation agent
-
A Model Context Protocol (MCP) server for querying deals and evaluations from the Opine CRM API.
Listado em Official MCP Registry (5)
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
-
ideation ai.actwise/ideation
Actwise Ideation helps founders benchmark startup and product ideas before they build.
-
Validate startup ideas with real people asking for them, each quote linked to its source.
-
public ai.colaunched/public
Business ideas from real public demand, scored with dated evidence. No account needed.
Listado em PyPI (MCP servers) (5)
-
Connect AI assistants to Outline for document search, reading, and management
-
Verifies news stories, mines SEO keywords, builds schema and reviews your draft. You write it.
-
AI-powered PowerPoint (.pptx) generation, editing, and review via MCP — 43 tools, 53 slide types, 12 chart types, 8 diagrams, 12 branded presets, 34 archetypes, 8 variant groups…
-
Account-bound, typed and durable stdio MCP gateway for the Kwork freelance marketplace
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
Listado em npm registry (MCP servers) (5)
-
MCP server for IdeaRoast: free startup idea gut check plus a paid 4-agent due diligence panel (market, tech, finance, timing)
-
Revenue intelligence for complex B2B growth.
-
AI marketing agent and AI ad generator: 1199 tools, usable alone. No model markup on Starter and up.
-
Clien.ai MCP server — deep product research from Claude Code.
-
Build and manage GrowSurf referral and affiliate programs through AI assistants.
Encontrados pelo significado, não por código ou repositório em comum: plugins semelhantes continuam sendo produtos distintos, e isto não é uma avaliação nem uma recomendação.
Quer esta marca no seu plugin em nosso catálogo?
Prove que o mantém com um arquivo no repositório, um arquivo no seu domínio ou um registro DNS, e você poderá mostrar esta marca na ficha, com banners ao vivo para o seu site e o README. Como funciona a verificação
Você também recebe alertas quando um marketplace o publica, o remove, muda a marca de verificado ou o que ele pede, e o endpoint remoto passa a ser monitorado como um serviço web.
Dados de Community GitHub marketplaces. Os números vêm das nossas próprias passagens regulares pelos marketplaces, última leitura em . Não publicamos dados de contato dos editores de plugins.