minimalist-entrepreneur
Claude Code skills based on The Minimalist Entrepreneur by Sahil Lavingia. Frameworks for building a profitable, sustainable business starting from community.
Lot de plugins · par Sahil Lavingia
Aperçu
minimalist-entrepreneur est un lot de plugins pour les outils de code IA publié par Sahil Lavingia. Places de marché que nous lisons et qui le référencent : 1 (Community GitHub marketplaces). Le dernier changement enregistré date du 2026-11-10. Selon notre passage sur les places de marché du 2026-11-11.
Ce qu'il demande
- S'installe comme lot de plugins
Aucune des places de marché que nous lisons ne publie ses outils ni les réglages qu'il demande.
Ce qu'il déclare, demande et exécute, en détail
N’installez que des plugins de développeurs en qui vous avez confiance. Nous reprenons ce que publient les places de marché et ne testons pas les plugins.
Fonctionne avec
- Claude Code
D'après les marketplaces qui le listent et le transport MCP qu'il déclare, tels que chaque client les documente. Nous ne testons pas les plugins.
Connecter
Commandes et configurations construites uniquement à partir de ce que déclarent ses places de marché. Nous ne les exécutons pas pour vous et ne testons pas les plugins.
En plugin Claude Code
Construit à partir de ce que déclare Community GitHub marketplaces.
/plugin marketplace add slavingia/skills
/plugin install minimalist-entrepreneur@minimalist-entrepreneurOù il est publié
| Place de marché | Statut | Version | Chiffres | Vérifié | Vu pour la première fois |
|---|---|---|---|---|---|
| Place de marché communautaire slavingia/skills (Ouvrir la source sur GitHub) | Référencé | 1.0.0 | Forks (GitHub): 1 123 Étoiles (GitHub): 11 158 |
Non marqué |
Chaque chiffre est celui de la place de marché et n'est jamais additionné entre places de marché. Une place de marché qui ne publie pas de chiffre n'en affiche aucun : pas de nombre ne veut pas dire zéro.
Listé dans une place de marché communautaire
| Place de marché | Dépôt | Étoiles (GitHub) |
|---|---|---|
| minimalist-entrepreneur | slavingia/skills | 11 158 |
Quelles places de marché nous lisons et comment nous les vérifions
Évolution de ses chiffres
- 2026-11-071,1 k
- 2026-11-091,1 k
- 2026-11-101,1 k
- 2026-11-0711,1 k
- 2026-11-0911,2 k
- 2026-11-1011,2 k
Chaque point est un jour où nous avons lu un autre nombre ; les paliers sont des jours sans changement. Les chiffres de places de marché différentes ne sont jamais additionnés.
Ce que contient le lot
Tel que publié sur Community GitHub marketplaces.
Skills: 10
company-valuesfind-communityfirst-customersgrow-sustainablymarketing-planminimalist-reviewmvppricingprocessizevalidate-idea
Ce qui a changé
- Est devenu un produit que nous suivons
- Community GitHub marketplaces: apparu
Plugins similaires
Produits dont les noms, descriptions, outils et skills sont les plus proches de celui-ci par le sens, sur toutes les places de marché que nous lisons. La proximité n'est classée qu'à l'intérieur de cette liste.
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
-
Founder & startup skills: Startup Idea Validator, Fundraising FAQ, Cap Table Explainer, Founder-Market Fit, Investor Cold Email, Runway Planner. Pressure-test an idea, prep for…
-
Essential skills for founders: SOPs, conversion optimization, viral hooks, lead magnets, social media writing, outreach, and strategic planning
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
Plugins similaires par place de marché
La même question posée à chaque place de marché séparément : y a-t-il là un équivalent de ce plugin ?
Référencé sur Claude Code: claude-plugins-community (5)
-
AI co-founder toolkit — ROI calculator, market intel, GTM playbook, pitch prep, investor materials, and social marketing. Built for founders who think in numbers.
-
Executive intelligence layer for solo founders — adversarial plan review, structured market research, and professional external-facing document production across an AI-powered…
-
Run a product initiative as a tracked journey — not a toolbox of one-shot answers. Persistent state across sessions: living PRD, evidence-typed hypotheses…
-
AI Product Discovery skills for Claude Code, powered by ClosedLoop AI. Deep-dive into any topic against all your product insights — every customer quote, pain point, business…
-
Product management skills for Claude Code. Gives Claude structured methodologies for discovery synthesis (JTBD, empathy mapping, journey mapping), user research design (interview…
Référencé sur Claude Code: claude-plugins-official (5)
-
Analyze business data and build custom Pigment models, metrics, and boards through natural language.
-
Government contracting research and capture workflows in Claude: opportunity and pipeline briefs, bid/no-bid and competitor analysis, price-to-win and proposal prep, powered by…
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
-
Help Claude Code champions run hackathons and office hours, find patterns worth sharing, help teammates climb the steps of AI adoption, and write a shareable AI maturity report.
-
QuickBooks business insights and actions: financial health briefings across P&L, cash flow, balance sheet and A/R, industry benchmarking, payroll cost analysis, overdue-invoice…
Référencé sur Claude: knowledge-work-plugins (5)
-
Write feature specs, plan roadmaps, and synthesize user research faster. Keep stakeholders updated and stay ahead of the competitive landscape.
-
Pre-built small business workflows to help you run and grow your business. Supports a majority of the tools you already use. You approve every step that touches money or…
-
Create content, plan campaigns, and analyze performance across marketing channels. Maintain brand voice consistency, track competitors, and report on what's working.
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
AI agent skills that make SaaS products data-ready for product analytics — from codebase scan to tracking plan to working instrumentation code.
Référencé sur Codex: openai-curated (openai/plugins) (5)
-
The Product Design plugin is built for turning early ideas into prototypes teams can review. It starts design and build work by confirming the brief, then helps teams explore…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
-
Shopify for ChatGPT makes store building and management as easy as having a conversation. Effortlessly connect your existing store or create a new online store by describing your…
-
Notion workflows for implementation planning, research synthesis, meeting preparation, and knowledge capture.
-
Develop your payments integration faster with the ability to create products, prices, and payment links directly in ChatGPT. Run your business from ChatGPT with the ability to…
Référencé sur Community GitHub marketplaces (3)
-
Design, validate, and plan a startup from scratch. Covers market research, competitive analysis, business model, brand identity, product definition, financial projections, and…
-
Eleven Claude skills that test a business before you launch it: a board, a competitor scout, a consumer panel of 100 buyer agents, pricing, the offer, a CFO, marketing, brand…
-
solo-startup
Use this skill when a solopreneur or solo startup founder needs to choose, validate, or operate a business within one person's cash, time, and support capacity, including…
Référencé sur Copilot CLI: github/awesome-copilot (5)
-
MCP server and 12 skills for product analysis, specification writing, strategy, narrative, and stakeholder alignment. Run competitive analyses, write zero-question specs, design…
-
Before your agent signs up for a paid API, LLM model, cloud service, SaaS plan, domain or anything else that costs money, it checks free tiers, right-sized plans and billing…
-
Turn your Copilot sessions into proof of impact — research-grounded HTML reports with effort estimation, skills analysis, and ROI metrics from local session logs.
-
Makes a 20 to 40 second launch film for a product from its website or App Store page: an MP4 at 1920x1080 with music, using the product's real logo, colors, fonts and screens…
-
Explore grouped customer feedback signals by impact and drill into a theme to guide product next steps.
Référencé sur Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
workiq-productivity
WorkIQ productivity skills powered by the local WorkIQ CLI — read-only insights across email, meetings, calendar, Teams, SharePoint, projects, and people.
-
workiq
Query Microsoft 365 data with natural language — emails, meetings, documents, Teams messages, and more.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Référencé sur Cursor: cursor/plugins (5)
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Generate presentations, documents, and webpages.
-
Search company knowledge and draft verified answers.
-
Research private companies, deals, investors, and funds.
-
Run your beehiiv newsletter from chat: draft and edit posts, organize subscribers with tags, custom fields, and segments, build automations, and review publication, post, and…
Référencé sur Docker MCP Catalog (5)
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
AI assistant for ingested content with anonymous access.
-
Production-ready RAG service to search and retrieve data from your documents.
-
Generate images, video, and audio with Glif's media-generation agent
-
A Model Context Protocol (MCP) server for querying deals and evaluations from the Opine CRM API.
Référencé sur Official MCP Registry (5)
-
Validate startup ideas with your AI assistant through Startup Ignition ToolSuite.
-
Score, validate, and pressure-test startup ideas with AI from Claude or any MCP agent.
-
ideation ai.actwise/ideation
Actwise Ideation helps founders benchmark startup and product ideas before they build.
-
Validate startup ideas with real people asking for them, each quote linked to its source.
-
public ai.colaunched/public
Business ideas from real public demand, scored with dated evidence. No account needed.
Référencé sur PyPI (MCP servers) (5)
-
Connect AI assistants to Outline for document search, reading, and management
-
Verifies news stories, mines SEO keywords, builds schema and reviews your draft. You write it.
-
AI-powered PowerPoint (.pptx) generation, editing, and review via MCP — 43 tools, 53 slide types, 12 chart types, 8 diagrams, 12 branded presets, 34 archetypes, 8 variant groups…
-
Account-bound, typed and durable stdio MCP gateway for the Kwork freelance marketplace
-
MCP server for VisiblyAI SEO tools - free local tools + paid API-powered SEO analysis
Référencé sur npm registry (MCP servers) (5)
-
MCP server for IdeaRoast: free startup idea gut check plus a paid 4-agent due diligence panel (market, tech, finance, timing)
-
Revenue intelligence for complex B2B growth.
-
AI marketing agent and AI ad generator: 1199 tools, usable alone. No model markup on Starter and up.
-
Clien.ai MCP server — deep product research from Claude Code.
-
Build and manage GrowSurf referral and affiliate programs through AI assistants.
Trouvés par le sens, et non par un code ou un dépôt commun : les plugins similaires restent des produits distincts, et ceci n'est ni un avis ni une recommandation.
Vous voulez cette marque pour votre plugin dans notre catalogue ?
Prouvez que vous le maintenez avec un fichier dans son dépôt, un fichier sur votre domaine ou un enregistrement DNS, et vous pourrez afficher cette marque sur la fiche, avec des bannières à jour pour votre site et votre README. Comment se passe la vérification
Vous recevez aussi des alertes quand une marketplace le publie, le retire, change sa marque vérifiée ou ce qu'il demande, et son endpoint distant est surveillé comme un service web.
Données issues de Community GitHub marketplaces. Les chiffres proviennent de nos propres passages réguliers sur les places de marché, dernière lecture le . Nous ne publions aucune coordonnée des éditeurs de plugins.