accessibility-agents
WCAG 2.2 AA enforcement as Agent Skills. Six router skills dispatch a specialist team across web, document, markdown, desktop and GitHub work; hooks block edits to user-facing…
Plugin-Paket · von Community Access
Überblick
accessibility-agents ist ein Plugin-Paket für KI-Coding-Tools von Community Access. Marktplätze, die wir lesen und die es listen: 1 (Community GitHub marketplaces). Die letzte erfasste Änderung war am 2026-10-21. Stand unseres Marktplatz-Durchlaufs vom 2026-10-23.
WCAG 2.2 AA enforcement as Agent Skills. Six router skills dispatch a specialist team across web, document, markdown, desktop and GitHub work; hooks block edits to user-facing files until the accessibility lead has reviewed; an MCP server supplies the scanners.
Was es abfragt
- Wird als Plugin-Paket installiert
Keiner der Marktplätze, die wir lesen, veröffentlicht seine Tools oder die abgefragten Einstellungen.
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Befehle und Konfigurationen nur aus den Angaben der Marktplätze. Wir führen sie nicht für Sie aus und testen keine Plugins.
Als Claude-Code-Plugin
Erstellt aus den Angaben von Community GitHub marketplaces.
/plugin marketplace add community-access/accessibility-agents
/plugin install accessibility-agents@community-accessWo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Community-Marktplatz community-access/accessibility-agents (Quelle auf GitHub öffnen) | Gelistet | 7.0.3 | Forks (GitHub): 51 Sterne (GitHub): 428 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
In einem Community-Marktplatz gelistet
| Marktplatz | Repository | Sterne (GitHub) |
|---|---|---|
| community-access | community-access/accessibility-agents | 428 |
Wie sich die Zahlen entwickelt haben
- 2026-10-1753
- 2026-10-2151
- 2026-10-2251
- 2026-10-18426
- 2026-10-20427
- 2026-10-21428
- 2026-10-22428
Jeder Punkt ist ein Tag, an dem wir eine andere Zahl gelesen haben; flache Abschnitte sind Tage ohne Veränderung. Zahlen verschiedener Marktplätze werden nie addiert.
Was das Paket enthält
So veröffentlicht auf Community GitHub marketplaces.
Skills: 108
a11y-corea11y-tool-builderaccessibility-leadaccessibility-regression-detectoraccessibility-statementactions-manageralt-text-headingsanalyticsaria-specialistci-accessibilitycognitive-accessibilitycompliance-mapping
Weitere anzeigen: 96
contrast-mastercontributions-hubcross-document-analyzercross-page-analyzerdaily-briefingdata-visualization-accessibilitydesign-system-auditordesktop-a11y-specialistdesktop-a11y-testing-coachdeveloper-hubdocument-accessibility-wizarddocument-csv-reporterdocument-inventoryemail-accessibilityepub-accessibilityepub-scan-configexcel-accessibilityforms-specialistgithub-hubi18n-accessibilityinsiders-a11y-trackerissue-trackerkb-accessibility-ruleskb-ci-integrationkb-cognitive-accessibilitykb-data-visualization-accessibilitykb-design-systemkb-document-scanningkb-email-accessibilitykb-framework-accessibilitykb-github-a11y-scannerkb-github-analytics-scoringkb-github-scanningkb-github-shared-instructionskb-github-workflow-standardskb-help-url-referencekb-legal-compliance-mappingkb-lighthouse-scannerkb-markdown-accessibilitykb-media-accessibilitykb-mobile-accessibilitykb-office-remediationkb-path-instructionskb-playwright-testingkb-python-developmentkb-report-generationkb-severity-mappingkb-testing-strategykb-web-scanningkb-web-severity-scoringkeyboard-navigatorlighthouse-bridgelink-checkerlive-region-controllermarkdown-a11y-assistantmarkdown-csv-reportermarkdown-fixermarkdown-scannermedia-accessibilitymobile-accessibilitymodal-specialistnotifications-managernvda-addon-specialistoffice-remediatoroffice-scan-configpdf-accessibilitypdf-remediatorpdf-scan-configperformance-accessibilityplaywright-scannerplaywright-verifierpowerpoint-accessibilitypr-reviewprojects-managerpython-specialistrelease-managerrepo-adminrepo-managerscanner-bridgescreen-reader-labsecurity-dashboardtables-data-specialistteam-managertemplate-buildertesting-coachtext-quality-reviewerwcag-aaawcag-guidewcag3-previewweb-accessibility-wizardweb-component-specialistweb-csv-reporterweb-issue-fixerwiki-managerword-accessibilitywxpython-specialist
Was sich geändert hat
- Wird seitdem als Produkt geführt
- Community GitHub marketplaces: erschienen
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Design, implement, and verify accessible experiences against WCAG 2.1 and 2.2, including runtime keyboard and focus validation, accessible Markdown authoring, and accessibility…
-
DevsForge Enterprise Accessibility Architect delivering comprehensive WCAG 2.1 AA compliance frameworks, inclusive design methodologies, and universal accessibility optimization…
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
-
Web accessibility scanning (WCAG 2.2 AA + KWCAG 2.2) with Korean remediation guides
-
The accessibility layer for AI coding agents: audit, fix, document and watch - WCAG 2.2.
-
wcag21-aa-legal-baseline-audit io.github.jmshinhwa/wcag21-aa-legal-baseline-audit
Audits HTML, JSX, Vue, Twig, Blade, ERB and Razor markup against the 24 WCAG 2.1 Level AA checks tha
-
wcag-accessibility io.github.aditya-ariosity/wcag-accessibility
A WCAG accessibility testing MCP for AI agents, Codex, Claude Code, and automated UI audits.
-
WCAG 2.2 AA accessibility checks for pages and HTML, run locally in headless Chrome.
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
10 expert audit lenses + full-audit orchestrator + 5 bundled reference skills. Review plans and code through the eyes of Design, UX, Frontend, Backend, Structural, Repo…
-
Lint agent configurations before they silently fail. 414 validation rules across Claude Code, Codex CLI, OpenCode, Cursor, GitHub Copilot, Gemini CLI, Cline, Windsurf, Roo Code…
-
Audits codebases and design systems against Apple's Human Interface Guidelines. Scans SwiftUI, UIKit, CSS, HTML, and JavaScript for HIG violations across iOS, iPadOS, macOS…
-
Five practical skills covering the domains developers most often Google when shipping a website. Each skill auto-loads only when relevant to the task: Web Accessibility on UI…
-
Your agent writes the code. Subtext proves it works. MCP tools for verification — persistent knowledge of your app, real-browser checks, and session replays your team can watch…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Agentforce Agent Development Life Cycle — author, discover, scaffold, deploy, test, and optimize .agent files
-
Keep your coding agent up to date with the latest web best practices
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
You.com agent skills for web search, research with citations, and content extraction. Guided integrations for Vercel AI SDK, Claude Agent SDK, OpenAI Agents SDK, crewAI…
Gelistet auf Claude: knowledge-work-plugins (5)
-
Keep your coding agent up to date with the latest web best practices
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Optional Qodo rules discovery and standards administration workflows.
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Use MagicPath to find, inspect, install, create, and edit UI components from Codex.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Gelistet auf Community GitHub marketplaces (4)
-
Design, implement, and verify accessible experiences against WCAG 2.1 and 2.2, including runtime keyboard and focus validation, accessible Markdown authoring, and accessibility…
-
DevsForge Enterprise Accessibility Architect delivering comprehensive WCAG 2.1 AA compliance frameworks, inclusive design methodologies, and universal accessibility optimization…
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Keep your coding agent up to date with the latest web best practices
-
Drive Microsoft AgentRC from Copilot chat: assess AI readiness, generate Copilot instructions (flat or nested with applyTo globs for monorepos), and manage policies. Produces a…
-
foundry-hosted-agent-copilotkit
Build CopilotKit + AG-UI web apps on Microsoft Foundry hosted agents (Microsoft Agent Framework): wiring, native Foundry primitives, human-in-the-loop approvals, azd deploy, and…
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Kanban board to manage accessibility issues, allow you to plan, track, and complete remediation work.
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
-
Advanced Security plugin for GitHub Copilot.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
Gelistet auf Cursor: cursor/plugins (5)
-
CLI-backed repo compatibility scans plus agents that audit startup, validation, and docs against reality.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Scaffold and validate new agent plugins.
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Gelistet auf Docker MCP Catalog (5)
-
playwright-mcp io.github.microsoft/playwright-mcp
Playwright Tools for MCP
-
Wayfound’s MCP server allows business users to govern, supervise, and improve AI Agents.
-
Documentation on AgentCore platform services.
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
-
Manage Zscaler Zero Trust Exchange via 400+ tools — ZPA, ZIA, ZDX, ZCC, ZTW, ZMS, EASM, and more.
Gelistet auf Official MCP Registry (5)
-
Web accessibility scanning (WCAG 2.2 AA + KWCAG 2.2) with Korean remediation guides
-
The accessibility layer for AI coding agents: audit, fix, document and watch - WCAG 2.2.
-
wcag21-aa-legal-baseline-audit io.github.jmshinhwa/wcag21-aa-legal-baseline-audit
Audits HTML, JSX, Vue, Twig, Blade, ERB and Razor markup against the 24 WCAG 2.1 Level AA checks tha
-
wcag-accessibility io.github.aditya-ariosity/wcag-accessibility
A WCAG accessibility testing MCP for AI agents, Codex, Claude Code, and automated UI audits.
-
WCAG 2.2 AA accessibility checks for pages and HTML, run locally in headless Chrome.
Gelistet auf npm registry (MCP servers) (5)
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
dsh-verify io.github.263311487-ux/dsh-verify
Agent-built web app quality gate. Real browser is the judge. PASS/FAIL with receipts.
-
Gives AI agents eyes and hands into running React Native apps: logs, REPL, tap, screenshots
-
One workspace for every AI coding assistant. Shared tasks, memory, and governance.
-
depwire io.github.atef-ataya/depwire
Dependency graph + 24 MCP tools. Impact analysis, simulation, security, agent coordination
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Möchten Sie dieses Zeichen für Ihr Plugin in unserem Katalog?
Belegen Sie mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag, dass Sie es pflegen, und Sie können dieses Zeichen auf der Karte zeigen, dazu Live-Banner für Ihre Website und Ihr README. So funktioniert die Verifizierung
Außerdem erhalten Sie Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Community GitHub marketplaces. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.