accessibility-agents
WCAG 2.2 AA enforcement as Agent Skills. Six router skills dispatch a specialist team across web, document, markdown, desktop and GitHub work; hooks block edits to user-facing…
Plugin bundle · by Community Access
About
accessibility-agents is a plugin bundle for AI coding tools published by Community Access. Marketplaces we read that list it: 1 (Community GitHub marketplaces). The last change we recorded was on 2026-10-21. As of our marketplace pass on 2026-10-22.
WCAG 2.2 AA enforcement as Agent Skills. Six router skills dispatch a specialist team across web, document, markdown, desktop and GitHub work; hooks block edits to user-facing files until the accessibility lead has reviewed; an MCP server supplies the scanners.
What it asks for
- Installs as a plugin bundle
None of the marketplaces we read publishes its tools or the settings it asks for.
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Works with
- Claude Code
From the marketplaces that list it and the MCP transport it declares, as each client documents them. We do not test plugins.
Connect
Commands and configs built only from what its marketplaces declare. We do not run them for you and do not test plugins.
As a Claude Code plugin
Built from what Community GitHub marketplaces declares.
/plugin marketplace add community-access/accessibility-agents
/plugin install accessibility-agents@community-accessWhere it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Community marketplace community-access/accessibility-agents (Open the source on GitHub) | Listed | 7.0.3 | Forks (GitHub): 51 Stars (GitHub): 428 |
Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
Listed in one community marketplace
| Marketplace | Repository | Stars (GitHub) |
|---|---|---|
| community-access | community-access/accessibility-agents | 428 |
How its figures have moved
- 2026-10-1753
- 2026-10-2151
- 2026-10-18426
- 2026-10-20427
- 2026-10-21428
Each dot is a day we read a different number; flat stretches are days the number did not move. Figures of different marketplaces are never added up.
What the bundle contains
As published on Community GitHub marketplaces.
Skills: 108
a11y-corea11y-tool-builderaccessibility-leadaccessibility-regression-detectoraccessibility-statementactions-manageralt-text-headingsanalyticsaria-specialistci-accessibilitycognitive-accessibilitycompliance-mapping
Show the remaining 96
contrast-mastercontributions-hubcross-document-analyzercross-page-analyzerdaily-briefingdata-visualization-accessibilitydesign-system-auditordesktop-a11y-specialistdesktop-a11y-testing-coachdeveloper-hubdocument-accessibility-wizarddocument-csv-reporterdocument-inventoryemail-accessibilityepub-accessibilityepub-scan-configexcel-accessibilityforms-specialistgithub-hubi18n-accessibilityinsiders-a11y-trackerissue-trackerkb-accessibility-ruleskb-ci-integrationkb-cognitive-accessibilitykb-data-visualization-accessibilitykb-design-systemkb-document-scanningkb-email-accessibilitykb-framework-accessibilitykb-github-a11y-scannerkb-github-analytics-scoringkb-github-scanningkb-github-shared-instructionskb-github-workflow-standardskb-help-url-referencekb-legal-compliance-mappingkb-lighthouse-scannerkb-markdown-accessibilitykb-media-accessibilitykb-mobile-accessibilitykb-office-remediationkb-path-instructionskb-playwright-testingkb-python-developmentkb-report-generationkb-severity-mappingkb-testing-strategykb-web-scanningkb-web-severity-scoringkeyboard-navigatorlighthouse-bridgelink-checkerlive-region-controllermarkdown-a11y-assistantmarkdown-csv-reportermarkdown-fixermarkdown-scannermedia-accessibilitymobile-accessibilitymodal-specialistnotifications-managernvda-addon-specialistoffice-remediatoroffice-scan-configpdf-accessibilitypdf-remediatorpdf-scan-configperformance-accessibilityplaywright-scannerplaywright-verifierpowerpoint-accessibilitypr-reviewprojects-managerpython-specialistrelease-managerrepo-adminrepo-managerscanner-bridgescreen-reader-labsecurity-dashboardtables-data-specialistteam-managertemplate-buildertesting-coachtext-quality-reviewerwcag-aaawcag-guidewcag3-previewweb-accessibility-wizardweb-component-specialistweb-csv-reporterweb-issue-fixerwiki-managerword-accessibilitywxpython-specialist
What changed
- Became a product we track
- Community GitHub marketplaces: appeared
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
Design, implement, and verify accessible experiences against WCAG 2.1 and 2.2, including runtime keyboard and focus validation, accessible Markdown authoring, and accessibility…
-
DevsForge Enterprise Accessibility Architect delivering comprehensive WCAG 2.1 AA compliance frameworks, inclusive design methodologies, and universal accessibility optimization…
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
-
Web accessibility scanning (WCAG 2.2 AA + KWCAG 2.2) with Korean remediation guides
-
The accessibility layer for AI coding agents: audit, fix, document and watch - WCAG 2.2.
-
wcag21-aa-legal-baseline-audit io.github.jmshinhwa/wcag21-aa-legal-baseline-audit
Audits HTML, JSX, Vue, Twig, Blade, ERB and Razor markup against the 24 WCAG 2.1 Level AA checks tha
-
wcag-accessibility io.github.aditya-ariosity/wcag-accessibility
A WCAG accessibility testing MCP for AI agents, Codex, Claude Code, and automated UI audits.
-
WCAG 2.2 AA accessibility checks for pages and HTML, run locally in headless Chrome.
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
10 expert audit lenses + full-audit orchestrator + 5 bundled reference skills. Review plans and code through the eyes of Design, UX, Frontend, Backend, Structural, Repo…
-
Lint agent configurations before they silently fail. 414 validation rules across Claude Code, Codex CLI, OpenCode, Cursor, GitHub Copilot, Gemini CLI, Cline, Windsurf, Roo Code…
-
Audits codebases and design systems against Apple's Human Interface Guidelines. Scans SwiftUI, UIKit, CSS, HTML, and JavaScript for HIG violations across iOS, iPadOS, macOS…
-
Five practical skills covering the domains developers most often Google when shipping a website. Each skill auto-loads only when relevant to the task: Web Accessibility on UI…
-
Your agent writes the code. Subtext proves it works. MCP tools for verification — persistent knowledge of your app, real-browser checks, and session replays your team can watch…
Has a listing on Claude Code: claude-plugins-official (5)
-
Agentforce Agent Development Life Cycle — author, discover, scaffold, deploy, test, and optimize .agent files
-
Keep your coding agent up to date with the latest web best practices
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
You.com agent skills for web search, research with citations, and content extraction. Guided integrations for Vercel AI SDK, Claude Agent SDK, OpenAI Agents SDK, crewAI…
Has a listing on Claude: knowledge-work-plugins (5)
-
Keep your coding agent up to date with the latest web best practices
-
Sanity content platform integration with MCP server, agent skills, and slash commands. Query and author content, build and optimize GROQ queries, design schemas, and set up Visual…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
-
Optional Qodo rules discovery and standards administration workflows.
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Use MagicPath to find, inspect, install, create, and edit UI components from Codex.
-
CrowdStrike Falcon Foundry development skills for building cybersecurity applications on the Falcon platform. Includes UI development, collections, functions, workflows, API…
-
Cloudflare platform plugin with curated skills for Workers, Wrangler, and Agents SDK plus the official Cloudflare API MCP server.
Has a listing on Community GitHub marketplaces (4)
-
Design, implement, and verify accessible experiences against WCAG 2.1 and 2.2, including runtime keyboard and focus validation, accessible Markdown authoring, and accessibility…
-
DevsForge Enterprise Accessibility Architect delivering comprehensive WCAG 2.1 AA compliance frameworks, inclusive design methodologies, and universal accessibility optimization…
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
-
WCAG accessibility auditing, compliance validation, UI testing for screen readers, keyboard navigation, and inclusive design
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Keep your coding agent up to date with the latest web best practices
-
Drive Microsoft AgentRC from Copilot chat: assess AI readiness, generate Copilot instructions (flat or nested with applyTo globs for monorepos), and manage policies. Produces a…
-
foundry-hosted-agent-copilotkit
Build CopilotKit + AG-UI web apps on Microsoft Foundry hosted agents (Microsoft Agent Framework): wiring, native Foundry primitives, human-in-the-loop approvals, azd deploy, and…
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Kanban board to manage accessibility issues, allow you to plan, track, and complete remediation work.
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Complete bundle: all Microsoft Skills for Fabric for developers and consumers.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
-
Advanced Security plugin for GitHub Copilot.
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
Has a listing on Cursor: cursor/plugins (5)
-
CLI-backed repo compatibility scans plus agents that audit startup, validation, and docs against reality.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Scaffold and validate new agent plugins.
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Has a listing on Docker MCP Catalog (5)
-
playwright-mcp io.github.microsoft/playwright-mcp
Playwright Tools for MCP
-
Wayfound’s MCP server allows business users to govern, supervise, and improve AI Agents.
-
Documentation on AgentCore platform services.
-
MCP server for AI access to SmartBear tools, including BugSnag, Reflect, Swagger, PactFlow, QTM4J.
-
Manage Zscaler Zero Trust Exchange via 400+ tools — ZPA, ZIA, ZDX, ZCC, ZTW, ZMS, EASM, and more.
Has a listing on Official MCP Registry (5)
-
Web accessibility scanning (WCAG 2.2 AA + KWCAG 2.2) with Korean remediation guides
-
The accessibility layer for AI coding agents: audit, fix, document and watch - WCAG 2.2.
-
wcag21-aa-legal-baseline-audit io.github.jmshinhwa/wcag21-aa-legal-baseline-audit
Audits HTML, JSX, Vue, Twig, Blade, ERB and Razor markup against the 24 WCAG 2.1 Level AA checks tha
-
wcag-accessibility io.github.aditya-ariosity/wcag-accessibility
A WCAG accessibility testing MCP for AI agents, Codex, Claude Code, and automated UI audits.
-
WCAG 2.2 AA accessibility checks for pages and HTML, run locally in headless Chrome.
Has a listing on npm registry (MCP servers) (5)
-
Discover and load Agent Skills from configured local directories and Git sources over stdio MCP.
-
dsh-verify io.github.263311487-ux/dsh-verify
Agent-built web app quality gate. Real browser is the judge. PASS/FAIL with receipts.
-
Gives AI agents eyes and hands into running React Native apps: logs, REPL, tap, screenshots
-
One workspace for every AI coding assistant. Shared tasks, memory, and governance.
-
depwire io.github.atef-ataya/depwire
Dependency graph + 24 MCP tools. Impact analysis, simulation, security, agent coordination
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Want this mark on your plugin in our catalog?
Prove you maintain it with a file in its repository, a file on your domain or a DNS record, and you can show this mark on the card, with live banners for your site and README. How verification works
You also get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from public marketplace files in GitHub repositories of their authors. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.