framecraft
Generate polished demo videos from a single prompt. The plugin teaches your LLM story structure, visual design, and narration craft, then orchestrates Playwright, FFmpeg, and Edge…
Plugin-Paket · von vaddisrinivas
Überblick
framecraft ist ein Plugin-Paket für KI-Coding-Tools von vaddisrinivas. Marktplätze, die wir lesen und die es listen: 1 (Claude Code: claude-plugins-community). Wir haben es erstmals am 2026-10-11 gesehen und seither keine Änderung erfasst. Stand unseres Marktplatz-Durchlaufs vom 2026-10-12.
Generate polished demo videos from a single prompt. The plugin teaches your LLM story structure, visual design, and narration craft, then orchestrates Playwright, FFmpeg, and Edge TTS MCP servers to render 1920x1080 videos with voiceover and transitions. No screen recording, no editing — describe your product and get a video.
Was es abfragt
- Wird als Plugin-Paket installiert
Keiner der Marktplätze, die wir lesen, veröffentlicht seine Tools oder die abgefragten Einstellungen.
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Verbinden
Keine Daten für einen automatischen Befehl: Die Angaben der Marktplätze sagen nicht eindeutig, wie man es verbindet.
Wo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Claude Code: claude-plugins-community (Quelle auf GitHub öffnen) | Gelistet | 0.5.0 | Forks (GitHub): 2 Sterne (GitHub): 8 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
Was das Paket enthält
So veröffentlicht auf Claude Code: claude-plugins-community.
MCP-Server: 4
edge-ttsffmpegframecraftplaywright
Skills: 1
framecraft
Was sich geändert hat
Bei diesem Plugin hat sich nichts bewegt, seit wir es beobachten.
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
Create AI-generated marketing videos using MuAPI's generative media APIs. Handles the complete pipeline: creative brief → storyboard → image generation → video animation →…
-
Turn a web app URL and a one-sentence instruction into an edited demo video with voiceover.
-
Generate AI explainer videos from prompts, scripts, audio files, or documents. Golpo creates animated explainer videos, podcast-to-video content, and script-to-video productions…
-
Professional AI video creation toolkit for Claude Code. Edit videos, generate video content, and enhance images using natural language.
-
This MCP lets your agent edit your videos, generate voiceovers, AI clips, titles, motion, music, etc
-
Create faceless short and long-form videos: script, stock footage, ElevenLabs voice, captions, MP4.
-
Write HTML, render video. Compositions, GSAP animations, captions, voiceovers, audio-reactive visuals, and website-to-video capture for HyperFrames.
-
Make animated videos by asking Claude, Cursor or any MCP client. Your AI writes it, we render it.
-
Make videos with Rubiic: start one from a brief, render it to MP4, export GIFs, stills and captions.
-
Talking-actor and faceless short videos from your AI agent, with a free quote before each render
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
Create AI-generated marketing videos using MuAPI's generative media APIs. Handles the complete pipeline: creative brief → storyboard → image generation → video animation →…
-
Generate AI explainer videos from prompts, scripts, audio files, or documents. Golpo creates animated explainer videos, podcast-to-video content, and script-to-video productions…
-
Professional AI video creation toolkit for Claude Code. Edit videos, generate video content, and enhance images using natural language.
-
Generate 2D animations and full explainer videos with VideoZero. Create engaging kinetic typography, illustrative charts, or animate complex algorithms and fomula.
-
Record and narrate demo, tutorial, onboarding, and product-walkthrough videos of your running web app, directly from Claude Code or Claude Desktop. Your agent reads your code…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Video generation at scale. Generate videos, images, and audio with Runway's API — batch ad campaigns, product videos, multishot stories, and creative iteration. Supports…
-
HyperFrames by HeyGen. Write HTML, render video. Compositions, GSAP and runtime adapter animations, captions, voiceovers, audio-reactive visuals, and website-to-video capture for…
-
Harness Adobe's creative AI-powered tools to edit images, automate design workflows, and bring creative visions to life — from background removal to vectorization and professional…
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
Gelistet auf Claude: knowledge-work-plugins (5)
-
Harness Adobe's creative AI-powered tools to edit images, automate design workflows, and bring creative visions to life — from background removal to vectorization and professional…
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Use Cloudinary directly in Claude. Manage assets, apply transformations, optimize media, and more through natural conversation.
-
Create production-ready Pendo in-app guides (walkthroughs, announcements, alerts, polls, promotions) as HTML/CSS/JS from a short intake conversation, using Pendo's guide…
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
Write HTML, render video. Compositions, GSAP animations, captions, voiceovers, audio-reactive visuals, and website-to-video capture for HyperFrames.
-
Remotion video creation skills — best practices, animations, audio, captions, 3D, and more for building programmatic videos with React.
-
Generate images and videos from a text prompt or your own photo. Turn a product shot into a video ad, restyle a photo, animate a still, or build a two-minute narrated explainer…
-
Adobe unlocks more ways to create and get work done from the conversation. Previously available as Photoshop, the Adobe connector now brings creativity and productivity…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
Gelistet auf Community GitHub marketplaces (5)
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Discover, compose, run, publish, and save Adobe Firefly workflows through the run-workflow MCP server, including predefined featured workflows for common marketing and production…
-
Official Carbone skill — complete templating language reference covering tags, loops, conditions, formatters, aggregators, and all output formats (DOCX, XLSX, PPTX, ODT, HTML…
-
Run growth marketing, SEO and AI answer-engine visibility for a product through AfterLaunch over MCP. Reads a ranked backlog of prepared, ready-to-ship growth moves.
-
YouTube outlier finder and competitor research. Ranks a channel's recent uploads and Shorts by how far each beat that channel's own baseline views, compares channels, and sweeps a…
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
Generate images using AI directly from your coding workflow. Supports OpenAI (gpt-image-2) and Google Gemini. BYO API key — the skill guides you through setup on first use.
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Draw simple diagrams in a Copilot canvas: shapes, arrows that stay attached, text and a freehand pen. Copilot can read, create and edit the same drawing, tidy its layout, and…
-
Record your screen doing a manual process, drop the video on your Desktop, and let Copilot CLI analyze it frame-by-frame to build working automation scripts. Supports narrated…
-
Interactive GitHub Copilot app canvas extension for building Animated PNG (APNG) files from frames. Draw or upload frames, tune per-frame timing and compositing, preview live…
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Gelistet auf Cursor: cursor/plugins (5)
-
Generate presentations, documents, and webpages.
-
Draw and export hand-drawn diagrams from chat.
-
Add Grok voice to an app: realtime speech-to-speech, speech-to-text dictation, text-to-speech read-aloud, and a log-driven fix loop for voice sessions.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Iterative self-referential AI loops using the Ralph Wiggum technique.
Gelistet auf Docker MCP Catalog (5)
-
Generate images, video, and audio with Glif's media-generation agent
-
AI image generation using Amazon Nova Canvas.
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
Official ElevenLabs Model Context Protocol (MCP) server that enables interaction with powerful Text to Speech and audio processing APIs.
-
Image generation server using EverArt's API.
Gelistet auf Official MCP Registry (5)
-
Turn a web app URL and a one-sentence instruction into an edited demo video with voiceover.
-
This MCP lets your agent edit your videos, generate voiceovers, AI clips, titles, motion, music, etc
-
Create faceless short and long-form videos: script, stock footage, ElevenLabs voice, captions, MP4.
-
Make animated videos by asking Claude, Cursor or any MCP client. Your AI writes it, we render it.
-
Make videos with Rubiic: start one from a brief, render it to MP4, export GIFs, stills and captions.
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Ist das Ihr Plugin?
Weisen Sie nach, dass Sie das Plugin pflegen: mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag. Sie erhalten Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, das Verifiziert-Zeichen oder die angeforderten Angaben ändert, und können den Remote-Endpunkt als Webdienst überwachen lassen.
Daten von Claude Code: claude-plugins-community. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.