framecraft
Generate polished demo videos from a single prompt. The plugin teaches your LLM story structure, visual design, and narration craft, then orchestrates Playwright, FFmpeg, and Edge…
Plugin bundle · by vaddisrinivas
About
framecraft is a plugin bundle for AI coding tools published by vaddisrinivas. Marketplaces we read that list it: 1 (Claude Code: claude-plugins-community). We first saw it on 2026-10-11 and have recorded no change since. As of our marketplace pass on 2026-10-12.
Generate polished demo videos from a single prompt. The plugin teaches your LLM story structure, visual design, and narration craft, then orchestrates Playwright, FFmpeg, and Edge TTS MCP servers to render 1920x1080 videos with voiceover and transitions. No screen recording, no editing — describe your product and get a video.
What it asks for
- Installs as a plugin bundle
None of the marketplaces we read publishes its tools or the settings it asks for.
What it declares, asks for and runs, in full
Only install plugins from developers you trust. We list what marketplaces publish and do not test plugins.
Works with
- Claude Code
From the marketplaces that list it and the MCP transport it declares, as each client documents them. We do not test plugins.
Connect
No data for an automatic command: what its marketplaces declare does not say unambiguously how to connect it.
Where it is published
| Marketplace | Status | Version | Figures | Verified | First seen |
|---|---|---|---|---|---|
| Claude Code: claude-plugins-community (Open the source on GitHub) | Listed | 0.5.0 | Forks (GitHub): 2 Stars (GitHub): 8 |
Not marked |
Each figure is the marketplace's own and is never added up across marketplaces. A marketplace that publishes no figure shows none: no number is not zero.
What the bundle contains
As published on Claude Code: claude-plugins-community.
MCP servers: 4
edge-ttsffmpegframecraftplaywright
Skills: 1
framecraft
What changed
Nothing has moved on this plugin since we started watching it.
Similar plugins
Products whose own names, descriptions, tools and skills are closest in meaning to this one, on every marketplace we read. Closeness is ranked within this list only.
-
Create AI-generated marketing videos using MuAPI's generative media APIs. Handles the complete pipeline: creative brief → storyboard → image generation → video animation →…
-
Turn a web app URL and a one-sentence instruction into an edited demo video with voiceover.
-
Generate AI explainer videos from prompts, scripts, audio files, or documents. Golpo creates animated explainer videos, podcast-to-video content, and script-to-video productions…
-
Professional AI video creation toolkit for Claude Code. Edit videos, generate video content, and enhance images using natural language.
-
This MCP lets your agent edit your videos, generate voiceovers, AI clips, titles, motion, music, etc
-
Create faceless short and long-form videos: script, stock footage, ElevenLabs voice, captions, MP4.
-
Write HTML, render video. Compositions, GSAP animations, captions, voiceovers, audio-reactive visuals, and website-to-video capture for HyperFrames.
-
Make animated videos by asking Claude, Cursor or any MCP client. Your AI writes it, we render it.
-
Make videos with Rubiic: start one from a brief, render it to MP4, export GIFs, stills and captions.
-
Talking-actor and faceless short videos from your AI agent, with a free quote before each render
Similar plugins by marketplace
The same question asked of one marketplace at a time: is there an analog of this plugin there?
Has a listing on Claude Code: claude-plugins-community (5)
-
Create AI-generated marketing videos using MuAPI's generative media APIs. Handles the complete pipeline: creative brief → storyboard → image generation → video animation →…
-
Generate AI explainer videos from prompts, scripts, audio files, or documents. Golpo creates animated explainer videos, podcast-to-video content, and script-to-video productions…
-
Professional AI video creation toolkit for Claude Code. Edit videos, generate video content, and enhance images using natural language.
-
Generate 2D animations and full explainer videos with VideoZero. Create engaging kinetic typography, illustrative charts, or animate complex algorithms and fomula.
-
Record and narrate demo, tutorial, onboarding, and product-walkthrough videos of your running web app, directly from Claude Code or Claude Desktop. Your agent reads your code…
Has a listing on Claude Code: claude-plugins-official (5)
-
Video generation at scale. Generate videos, images, and audio with Runway's API — batch ad campaigns, product videos, multishot stories, and creative iteration. Supports…
-
HyperFrames by HeyGen. Write HTML, render video. Compositions, GSAP and runtime adapter animations, captions, voiceovers, audio-reactive visuals, and website-to-video capture for…
-
Harness Adobe's creative AI-powered tools to edit images, automate design workflows, and bring creative visions to life — from background removal to vectorization and professional…
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Design or redesign frontend UI and marketing graphics on the Superdesign infinite canvas. Reads your codebase for context, sets up a design system, and generates branchable design…
Has a listing on Claude: knowledge-work-plugins (5)
-
Harness Adobe's creative AI-powered tools to edit images, automate design workflows, and bring creative visions to life — from background removal to vectorization and professional…
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Use Cloudinary directly in Claude. Manage assets, apply transformations, optimize media, and more through natural conversation.
-
Create production-ready Pendo in-app guides (walkthroughs, announcements, alerts, polls, promotions) as HTML/CSS/JS from a short intake conversation, using Pendo's guide…
-
Accelerate design workflows — critique, design system management, UX writing, accessibility audits, research synthesis, and dev handoff. From exploration to pixel-perfect specs.
Has a listing on Codex: openai-curated (openai/plugins) (5)
-
Write HTML, render video. Compositions, GSAP animations, captions, voiceovers, audio-reactive visuals, and website-to-video capture for HyperFrames.
-
Remotion video creation skills — best practices, animations, audio, captions, 3D, and more for building programmatic videos with React.
-
Generate images and videos from a text prompt or your own photo. Turn a product shot into a video ad, restyle a photo, animate a still, or build a two-minute narrated explainer…
-
Adobe unlocks more ways to create and get work done from the conversation. Previously available as Photoshop, the Adobe connector now brings creativity and productivity…
-
Explore campaign ideas, concept images, mood boards, product placements, ad directions, listing images, social posts, and launch assets.
Has a listing on Community GitHub marketplaces (5)
-
Create, edit, review, resize, and brand-check Canva designs with the Canva MCP server.
-
Discover, compose, run, publish, and save Adobe Firefly workflows through the run-workflow MCP server, including predefined featured workflows for common marketing and production…
-
Official Carbone skill — complete templating language reference covering tags, loops, conditions, formatters, aggregators, and all output formats (DOCX, XLSX, PPTX, ODT, HTML…
-
Run growth marketing, SEO and AI answer-engine visibility for a product through AfterLaunch over MCP. Reads a ranked backlog of prepared, ready-to-ship growth moves.
-
YouTube outlier finder and competitor research. Ranks a channel's recent uploads and Shorts by how far each beat that channel's own baseline views, compares channels, and sweeps a…
Has a listing on Copilot CLI: github/awesome-copilot (5)
-
Generate images using AI directly from your coding workflow. Supports OpenAI (gpt-image-2) and Google Gemini. BYO API key — the skill guides you through setup on first use.
-
Figma design platform integration. Access design files, extract component information, read design tokens, and translate designs into code. Bridge the gap between design and…
-
Draw simple diagrams in a Copilot canvas: shapes, arrows that stay attached, text and a freehand pen. Copilot can read, create and edit the same drawing, tidy its layout, and…
-
Record your screen doing a manual process, drop the video on your Desktop, and let Copilot CLI analyze it frame-by-frame to build working automation scripts. Supports narrated…
-
Interactive GitHub Copilot app canvas extension for building Animated PNG (APNG) files from frames. Draw or upload frames, tune per-frame timing and compositing, preview live…
Has a listing on Copilot CLI: github/copilot-plugins (5)
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
Build Power Apps Canvas Apps using the Canvas Authoring MCP server.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
mcp-apps
Generate MCP App widgets for MCP tools. Produces self-contained HTML widgets using the MCP Apps protocol.
-
model-apps
Build and deploy Power Apps generative pages for model-driven apps with specialist agents for planning, entity creation, and parallel code generation. Requires PAC CLI >= 2.7.0…
Has a listing on Cursor: cursor/plugins (5)
-
Generate presentations, documents, and webpages.
-
Draw and export hand-drawn diagrams from chat.
-
Add Grok voice to an app: realtime speech-to-speech, speech-to-text dictation, text-to-speech read-aloud, and a log-driven fix loop for voice sessions.
-
Consult a stronger model before major decisions, when stuck, and before declaring done.
-
Iterative self-referential AI loops using the Ralph Wiggum technique.
Has a listing on Docker MCP Catalog (5)
-
Generate images, video, and audio with Glif's media-generation agent
-
AI image generation using Amazon Nova Canvas.
-
A Model Context Protocol (MCP) server that empowers LLMs to use some of Open Srategy Partners' core writing and product marketing techniques.
-
Official ElevenLabs Model Context Protocol (MCP) server that enables interaction with powerful Text to Speech and audio processing APIs.
-
Image generation server using EverArt's API.
Has a listing on Official MCP Registry (5)
-
Turn a web app URL and a one-sentence instruction into an edited demo video with voiceover.
-
This MCP lets your agent edit your videos, generate voiceovers, AI clips, titles, motion, music, etc
-
Create faceless short and long-form videos: script, stock footage, ElevenLabs voice, captions, MP4.
-
Make animated videos by asking Claude, Cursor or any MCP client. Your AI writes it, we render it.
-
Make videos with Rubiic: start one from a brief, render it to MP4, export GIFs, stills and captions.
Found by meaning, not by shared code or a shared repository: similar plugins stay separate products, and this is not a review or a recommendation.
Is this your plugin?
Add it to your projects and prove you maintain it with a file in its repository, a file on your domain or a DNS record. You get alerts when a marketplace lists it, drops it, changes its verified mark or what it asks for, and its remote endpoint goes on monitoring as a web service.
Data comes from the public marketplace file https://github.com/anthropics/claude-plugins-community/blob/HEAD/.claude-plugin/marketplace.json. Figures come from our own regular passes over the marketplaces, last read on . We publish no contact details for plugin publishers.