agent-protocols
Pacote de plugins · arneesh
agent-protocols é um pacote de plugins para ferramentas de programação com IA publicado por arneesh. Marketplaces que lemos e que o listam: 1 (Claude Code: claude-plugins-community). Vimos pela primeira vez em 2026-10-11 e não registramos mudanças desde então. Conforme nossa passagem pelos marketplaces em 2026-10-12.
Structured engineering protocols that make AI coding agents work like senior engineers.
- Marketplaces
- 1
- Onde roda
- Instala-se como pacote de plugins
- Maior número publicado
- 1 Estrelas (GitHub) · Claude Code: claude-plugins-community
- Visto pela primeira vez
- 2026-10-11
- Última mudança
- Nenhuma registrada
- Marca de verificação
- Sem marcação
Onde está publicado
| Marketplace | Status | Versão | Números | Verificado | Visto pela primeira vez |
|---|---|---|---|---|---|
| Claude Code: claude-plugins-community (Abrir o código no GitHub) | Listado | 1.0.0 | Forks (GitHub): 0 Estrelas (GitHub): 1 |
Sem marcação |
Cada número é do próprio marketplace e nunca é somado entre marketplaces. Um marketplace que não publica números não mostra nenhum: sem número não é zero.
O que pode fazer
Instala-se na ferramenta de IA como pacote de plugins; o que ele inicia está listado abaixo.
- Ferramentas que declara
- Não publicado
- Variáveis de ambiente que pede
- Não publicado
- Hooks que executa
- 1
O que o pacote contém
Conforme publicado em Claude Code: claude-plugins-community.
Skills: 25
api-and-interface-designbrowser-testing-with-devtoolsci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringdebugging-and-error-recoverydeprecation-and-migrationdocumentation-and-adrsfrontend-ui-engineeringgit-workflow-and-versioningidea-refine
Mostrar mais 13
incident-response-and-postmortemsincremental-implementationinternationalization-and-localizationkarpathy-guidelinesperformance-optimizationplanning-and-task-breakdownresearch-spike-and-pocsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Comandos: 7
buildcode-simplifyplanreviewshipspectest
Agentes: 8
accessibility-specialistcode-reviewerdocumentation-specialistperformance-engineerrelease-engineersecurity-auditorspec-analysttest-engineer
Hooks: 1
SessionStart
O que mudou
Nada mudou neste plugin desde que começamos a acompanhá-lo.
O editor
arneesh · Repositório: github.com/arneesh/agent-protocols
Plugins semelhantes
Produtos cujos próprios nomes, descrições, ferramentas e skills são os mais próximos deste pelo significado, em todos os marketplaces que lemos. A proximidade é ordenada apenas dentro desta lista.
- harness-engineeringAI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
- launchpadThe most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
- agent-runwayPrevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
- claude-code-kitTurn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
- ai-devkitA structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
- nexus-agentsIntelligent orchestration platform for AI coding tools. Coordinates Claude, Codex, Gemini, and OpenCode through a single MCP server — routing each task to the best model using…
- AI Dev KitAI Dev Kit is a complete plugin-oriented developer workspace for AI coding assistants. It ships everything needed to run professional-grade engineering workflows — TDD, code…
- tkSpec-driven workflow for AI coding agents: PRD, plan, check, and archive features using tracer-bullet vertical slices.
- Endor Labs Agent KitEndor Labs workflow agents and setup for Claude Code.
- rkstackComplete AI development workflow — 22 skills that guide the full cycle from idea to shipped code. Brainstorm a design, write an implementation plan, execute with TDD, debug…
Plugins semelhantes por marketplace
A mesma pergunta feita a cada marketplace separadamente: existe lá um equivalente deste plugin?
Listado em Claude Code: claude-plugins-community (5)
- harness-engineeringAI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
- launchpadThe most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
- agent-runwayPrevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
- claude-code-kitTurn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
- ai-devkitA structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
Listado em Claude Code: claude-plugins-official (5)
- feature-devComprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
- atomic-agentsComprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
- QodoBring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
- claude-code-setupAnalyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
- mattpocock-skillsMatt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
Listado em Claude: knowledge-work-plugins (5)
- QodoBring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
- buildkiteOfficial Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
- AI-FirstifyAI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
- EngineeringStreamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
- modern-web-guidanceKeep your coding agent up to date with the latest web best practices
Listado em Codex: openai-curated (openai/plugins) (5)
- SuperpowersAn agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
- Plugin EvalEvaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
- CodeRabbitAI-powered code review in Codex, powered by CodeRabbit.
- GitHubInspect repositories, triage pull requests and issues, debug CI, and publish changes through a hybrid GitHub connector and CLI workflow.
- QodoQodo setup, code intelligence, and review workflows.
Listado em Community GitHub marketplaces (5)
- Endor Labs Agent KitEndor Labs workflow agents and setup for Claude Code.
- atomic-agentsComprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
- buildkiteOfficial Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
- sourcery-agentSourcery security findings for AI coding agents: triage and minimal-change remediation via the public Sourcery API (12 MCP tools + skills).
- appwriteAppwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Listado em Copilot CLI: github/awesome-copilot (5)
- software-engineering-team7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
- awesome-copilotMeta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
- copilot-goal-skillGoal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
- ai-readyAnalyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
- copilot-sdkBuild applications with the GitHub Copilot SDK across multiple programming languages. Includes comprehensive instructions for C#, Go, Node.js/TypeScript, and Python to help you…
Listado em Copilot CLI: github/copilot-plugins (5)
- azure-devops-copilot-pluginBring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
- advanced-securityAdvanced Security plugin for GitHub Copilot.
- microsoft-365-agents-toolkitToolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
- code-apps-previewBuild and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
- cpp-language-serverNavigate and interact with your C++ code using the Microsoft C++ Language Server.
Listado em Cursor: cursor/plugins (5)
- pstackif you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
- CLI for AgentsPatterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
- Origin AppsSkills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
- Cursor SDKBuild apps, scripts, and automations with the TypeScript SDK.
- Cursor Team KitInternal team workflows for CI, code review, shipping, local automation, and verification.
Listado em Docker MCP Catalog (5)
- Sequa.AIStop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
- ZenBridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
- EffectTools and resources for writing Effect code in Typescript.
- GitHubConnect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
- Ref - Up-To-Date DocsRef powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
Listado em Official MCP Registry (5)
- patchwork — Codebase Conventions for AI AgentsScan any codebase, generate CONVENTIONS.md, expose conventions as MCP tools for AI agents.
- AGENTS.md GeneratorAnalyzes codebases with tree-sitter and generates AGENTS.md files for AI coding agents.
- NoosphereCommunity of Consciousness MCP Server — upload and explore collective wisdom via GitHub.
- agent-comm io.github.keshrath/agent-commAgent intercommunication - messaging, channels, shared state, and real-time events
- ContinueWithInstall the ContinueWith AI handoff widget from coding agents (Cursor, Claude Code, Codex).
Encontrados pelo significado, não por código ou repositório em comum: plugins semelhantes continuam sendo produtos distintos, e isto não é uma avaliação nem uma recomendação.
Este plugin é seu?
Comprove que você mantém o plugin com um arquivo no repositório, um arquivo no seu domínio ou um registro DNS. Você recebe alertas quando um marketplace o publica, o remove, muda o selo de verificado ou o que ele pede, e pode colocar o endpoint remoto em monitoramento como serviço web.
Dados de Claude Code: claude-plugins-community. Os números vêm das nossas próprias passagens regulares pelos marketplaces, última leitura em . Não publicamos dados de contato dos editores de plugins.