agent-protocols
Structured engineering protocols that make AI coding agents work like senior engineers.
Plugin-Paket · von arneesh
Überblick
agent-protocols ist ein Plugin-Paket für KI-Coding-Tools von arneesh. Marktplätze, die wir lesen und die es listen: 1 (Claude Code: claude-plugins-community). Wir haben es erstmals am 2026-10-11 gesehen und seither keine Änderung erfasst. Stand unseres Marktplatz-Durchlaufs vom 2026-10-12.
Was es abfragt
- Wird als Plugin-Paket installiert
- Deklarierte Hooks: 1
Was es deklariert, abfragt und ausführt, vollständig
Installieren Sie nur Plugins von Entwicklern, denen Sie vertrauen. Wir zeigen, was die Marktplätze veröffentlichen, und testen keine Plugins.
Funktioniert mit
- Claude Code
Nach den Marktplätzen, die ihn listen, und dem angegebenen MCP-Transport, wie jeder Client sie dokumentiert. Wir testen keine Plugins.
Verbinden
Keine Daten für einen automatischen Befehl: Die Angaben der Marktplätze sagen nicht eindeutig, wie man es verbindet.
Wo es veröffentlicht ist
| Marktplatz | Status | Version | Zahlen | Verifiziert | Erstmals gesehen |
|---|---|---|---|---|---|
| Claude Code: claude-plugins-community (Quelle auf GitHub öffnen) | Gelistet | 1.0.0 | Forks (GitHub): 0 Sterne (GitHub): 1 |
Nicht markiert |
Jede Zahl stammt vom jeweiligen Marktplatz und wird nie über Marktplätze hinweg addiert. Ein Marktplatz ohne veröffentlichte Zahl zeigt keine: keine Zahl ist nicht null.
Was das Paket enthält
So veröffentlicht auf Claude Code: claude-plugins-community.
Skills: 25
api-and-interface-designbrowser-testing-with-devtoolsci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringdebugging-and-error-recoverydeprecation-and-migrationdocumentation-and-adrsfrontend-ui-engineeringgit-workflow-and-versioningidea-refine
Weitere anzeigen: 13
incident-response-and-postmortemsincremental-implementationinternationalization-and-localizationkarpathy-guidelinesperformance-optimizationplanning-and-task-breakdownresearch-spike-and-pocsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Befehle: 7
buildcode-simplifyplanreviewshipspectest
Agenten: 8
accessibility-specialistcode-reviewerdocumentation-specialistperformance-engineerrelease-engineersecurity-auditorspec-analysttest-engineer
Hooks: 1
SessionStart
Was sich geändert hat
Bei diesem Plugin hat sich nichts bewegt, seit wir es beobachten.
Ähnliche Plugins
Produkte, deren eigene Namen, Beschreibungen, Werkzeuge und Skills diesem der Bedeutung nach am nächsten sind, auf allen Marktplätzen, die wir lesen. Die Nähe ist nur innerhalb dieser Liste geordnet.
-
AI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
-
The most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
-
Prevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
-
Turn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
Intelligent orchestration platform for AI coding tools. Coordinates Claude, Codex, Gemini, and OpenCode through a single MCP server — routing each task to the best model using…
-
AI Dev Kit is a complete plugin-oriented developer workspace for AI coding assistants. It ships everything needed to run professional-grade engineering workflows — TDD, code…
-
Spec-driven workflow for AI coding agents: PRD, plan, check, and archive features using tracer-bullet vertical slices.
-
Endor Labs workflow agents and setup for Claude Code.
-
Complete AI development workflow — 22 skills that guide the full cycle from idea to shipped code. Brainstorm a design, write an implementation plan, execute with TDD, debug…
Ähnliche Plugins nach Marktplatz
Dieselbe Frage an jeden Marktplatz einzeln: Gibt es dort ein Gegenstück zu diesem Plugin?
Gelistet auf Claude Code: claude-plugins-community (5)
-
AI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
-
The most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
-
Prevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
-
Turn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
Gelistet auf Claude Code: claude-plugins-official (5)
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
Gelistet auf Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Keep your coding agent up to date with the latest web best practices
Gelistet auf Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
AI-powered code review in Codex, powered by CodeRabbit.
-
Inspect repositories, triage pull requests and issues, debug CI, and publish changes through a hybrid GitHub connector and CLI workflow.
-
Qodo setup, code intelligence, and review workflows.
Gelistet auf Community GitHub marketplaces (5)
-
Endor Labs workflow agents and setup for Claude Code.
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Sourcery security findings for AI coding agents: triage and minimal-change remediation via the public Sourcery API (12 MCP tools + skills).
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Gelistet auf Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Build applications with the GitHub Copilot SDK across multiple programming languages. Includes comprehensive instructions for C#, Go, Node.js/TypeScript, and Python to help you…
Gelistet auf Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Advanced Security plugin for GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Navigate and interact with your C++ code using the Microsoft C++ Language Server.
Gelistet auf Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Gelistet auf Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Tools and resources for writing Effect code in Typescript.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
Gelistet auf Official MCP Registry (5)
-
patchwork — Codebase Conventions for AI Agents
Scan any codebase, generate CONVENTIONS.md, expose conventions as MCP tools for AI agents.
-
Analyzes codebases with tree-sitter and generates AGENTS.md files for AI coding agents.
-
Community of Consciousness MCP Server — upload and explore collective wisdom via GitHub.
-
agent-comm io.github.keshrath/agent-comm
Agent intercommunication - messaging, channels, shared state, and real-time events
-
Install the ContinueWith AI handoff widget from coding agents (Cursor, Claude Code, Codex).
Nach Bedeutung gefunden, nicht über gemeinsamen Code oder ein gemeinsames Repository: Ähnliche Plugins bleiben getrennte Produkte, und dies ist weder eine Bewertung noch eine Empfehlung.
Ist das Ihr Plugin?
Fügen Sie es Ihren Projekten hinzu und belegen Sie, dass Sie es pflegen: mit einer Datei im Repository, einer Datei auf Ihrer Domain oder einem DNS-Eintrag. Sie erhalten Hinweise, wenn ein Marktplatz es aufnimmt, entfernt, sein Verified-Zeichen oder seine Anforderungen ändert, und sein Remote-Endpunkt wird wie ein Webdienst überwacht.
Daten von Claude Code: claude-plugins-community. Die Zahlen stammen aus unseren eigenen regelmäßigen Durchläufen über die Marktplätze, zuletzt abgerufen am . Kontaktdaten von Plugin-Herausgebern veröffentlichen wir nicht.