agent-protocols
Structured engineering protocols that make AI coding agents work like senior engineers.
Paquete de plugins · de arneesh
Resumen
agent-protocols es un paquete de plugins para herramientas de programación con IA publicado por arneesh. Marketplaces que leemos y que lo publican: 1 (Claude Code: claude-plugins-community). Lo vimos por primera vez el 2026-10-11 y desde entonces no hemos registrado cambios. Según nuestra pasada por los marketplaces del 2026-10-12.
Qué pide
- Se instala como paquete de plugins
- Hooks declarados: 1
Lo que declara, pide y ejecuta, completo
Instale solo plugins de desarrolladores en los que confíe. Mostramos lo que publican los marketplaces y no probamos plugins.
Conectar
No hay datos para un comando automático: lo que declaran sus marketplaces no dice de forma inequívoca cómo conectarlo.
Dónde está publicado
| Marketplace | Estado | Versión | Cifras | Verificado | Visto por primera vez |
|---|---|---|---|---|---|
| Claude Code: claude-plugins-community (Abrir el código en GitHub) | Publicado | 1.0.0 | Forks (GitHub): 0 Estrellas (GitHub): 1 |
Sin marca |
Cada cifra es del propio marketplace y nunca se suma entre marketplaces. Un marketplace que no publica cifras no muestra ninguna: sin número no es cero.
Qué contiene el paquete
Tal como se publica en Claude Code: claude-plugins-community.
Skills: 25
api-and-interface-designbrowser-testing-with-devtoolsci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringdebugging-and-error-recoverydeprecation-and-migrationdocumentation-and-adrsfrontend-ui-engineeringgit-workflow-and-versioningidea-refine
Mostrar los otros 13
incident-response-and-postmortemsincremental-implementationinternationalization-and-localizationkarpathy-guidelinesperformance-optimizationplanning-and-task-breakdownresearch-spike-and-pocsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Comandos: 7
buildcode-simplifyplanreviewshipspectest
Agentes: 8
accessibility-specialistcode-reviewerdocumentation-specialistperformance-engineerrelease-engineersecurity-auditorspec-analysttest-engineer
Hooks: 1
SessionStart
Qué cambió
Nada ha cambiado en este plugin desde que lo seguimos.
Plugins similares
Productos cuyos propios nombres, descripciones, herramientas y skills son los más cercanos a este por su significado, en todos los marketplaces que leemos. La cercanía se ordena solo dentro de esta lista.
-
AI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
-
The most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
-
Prevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
-
Turn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
Intelligent orchestration platform for AI coding tools. Coordinates Claude, Codex, Gemini, and OpenCode through a single MCP server — routing each task to the best model using…
-
AI Dev Kit is a complete plugin-oriented developer workspace for AI coding assistants. It ships everything needed to run professional-grade engineering workflows — TDD, code…
-
Spec-driven workflow for AI coding agents: PRD, plan, check, and archive features using tracer-bullet vertical slices.
-
Endor Labs workflow agents and setup for Claude Code.
-
Complete AI development workflow — 22 skills that guide the full cycle from idea to shipped code. Brainstorm a design, write an implementation plan, execute with TDD, debug…
Plugins similares por marketplace
La misma pregunta a cada marketplace por separado: ¿hay allí un equivalente de este plugin?
Publicado en Claude Code: claude-plugins-community (5)
-
AI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
-
The most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
-
Prevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
-
Turn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
Publicado en Claude Code: claude-plugins-official (5)
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
Publicado en Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Keep your coding agent up to date with the latest web best practices
Publicado en Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
AI-powered code review in Codex, powered by CodeRabbit.
-
Inspect repositories, triage pull requests and issues, debug CI, and publish changes through a hybrid GitHub connector and CLI workflow.
-
Qodo setup, code intelligence, and review workflows.
Publicado en Community GitHub marketplaces (5)
-
Endor Labs workflow agents and setup for Claude Code.
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Sourcery security findings for AI coding agents: triage and minimal-change remediation via the public Sourcery API (12 MCP tools + skills).
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Publicado en Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Build applications with the GitHub Copilot SDK across multiple programming languages. Includes comprehensive instructions for C#, Go, Node.js/TypeScript, and Python to help you…
Publicado en Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Advanced Security plugin for GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Navigate and interact with your C++ code using the Microsoft C++ Language Server.
Publicado en Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Publicado en Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Tools and resources for writing Effect code in Typescript.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
Publicado en Official MCP Registry (5)
-
patchwork — Codebase Conventions for AI Agents
Scan any codebase, generate CONVENTIONS.md, expose conventions as MCP tools for AI agents.
-
Analyzes codebases with tree-sitter and generates AGENTS.md files for AI coding agents.
-
Community of Consciousness MCP Server — upload and explore collective wisdom via GitHub.
-
agent-comm io.github.keshrath/agent-comm
Agent intercommunication - messaging, channels, shared state, and real-time events
-
Install the ContinueWith AI handoff widget from coding agents (Cursor, Claude Code, Codex).
Encontrados por significado, no por código ni repositorio compartidos: los plugins similares siguen siendo productos distintos, y esto no es una reseña ni una recomendación.
¿Es tu plugin?
Demuestre que mantiene el plugin con un archivo en su repositorio, un archivo en su dominio o un registro DNS. Recibirá avisos cuando un marketplace lo publique, lo retire, cambie su marca de verificado o lo que pide, y podrá poner su endpoint remoto en monitorización como servicio web.
Datos de Claude Code: claude-plugins-community. Las cifras proceden de nuestros propios recorridos periódicos por los marketplaces, leída por última vez el . No publicamos datos de contacto de los editores de plugins.