agent-protocols
Structured engineering protocols that make AI coding agents work like senior engineers.
Lot de plugins · par arneesh
Aperçu
agent-protocols est un lot de plugins pour les outils de code IA publié par arneesh. Places de marché que nous lisons et qui le référencent : 1 (Claude Code: claude-plugins-community). Nous l'avons vu pour la première fois le 2026-10-11 et n'avons enregistré aucun changement depuis. Selon notre passage sur les places de marché du 2026-10-12.
Ce qu'il demande
- S'installe comme lot de plugins
- Hooks : 1
Ce qu'il déclare, demande et exécute, en détail
N’installez que des plugins de développeurs en qui vous avez confiance. Nous reprenons ce que publient les places de marché et ne testons pas les plugins.
Connecter
Pas de données pour une commande automatique : ce que déclarent ses places de marché ne dit pas sans ambiguïté comment le connecter.
Où il est publié
| Place de marché | Statut | Version | Chiffres | Vérifié | Vu pour la première fois |
|---|---|---|---|---|---|
| Claude Code: claude-plugins-community (Ouvrir la source sur GitHub) | Référencé | 1.0.0 | Forks (GitHub): 0 Étoiles (GitHub): 1 |
Non marqué |
Chaque chiffre est celui de la place de marché et n'est jamais additionné entre places de marché. Une place de marché qui ne publie pas de chiffre n'en affiche aucun : pas de nombre ne veut pas dire zéro.
Ce que contient le lot
Tel que publié sur Claude Code: claude-plugins-community.
Skills: 25
api-and-interface-designbrowser-testing-with-devtoolsci-cd-and-automationcode-review-and-qualitycode-simplificationcontext-engineeringdebugging-and-error-recoverydeprecation-and-migrationdocumentation-and-adrsfrontend-ui-engineeringgit-workflow-and-versioningidea-refine
Afficher les autres : 13
incident-response-and-postmortemsincremental-implementationinternationalization-and-localizationkarpathy-guidelinesperformance-optimizationplanning-and-task-breakdownresearch-spike-and-pocsecurity-and-hardeningshipping-and-launchsource-driven-developmentspec-driven-developmenttest-driven-developmentusing-agent-skills
Commandes: 7
buildcode-simplifyplanreviewshipspectest
Agents: 8
accessibility-specialistcode-reviewerdocumentation-specialistperformance-engineerrelease-engineersecurity-auditorspec-analysttest-engineer
Hooks: 1
SessionStart
Ce qui a changé
Rien n'a bougé sur ce plugin depuis que nous le suivons.
Plugins similaires
Produits dont les noms, descriptions, outils et skills sont les plus proches de celui-ci par le sens, sur toutes les places de marché que nous lisons. La proximité n'est classée qu'à l'intérieur de cette liste.
-
AI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
-
The most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
-
Prevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
-
Turn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
-
Intelligent orchestration platform for AI coding tools. Coordinates Claude, Codex, Gemini, and OpenCode through a single MCP server — routing each task to the best model using…
-
AI Dev Kit is a complete plugin-oriented developer workspace for AI coding assistants. It ships everything needed to run professional-grade engineering workflows — TDD, code…
-
Spec-driven workflow for AI coding agents: PRD, plan, check, and archive features using tracer-bullet vertical slices.
-
Endor Labs workflow agents and setup for Claude Code.
-
Complete AI development workflow — 22 skills that guide the full cycle from idea to shipped code. Brainstorm a design, write an implementation plan, execute with TDD, debug…
Plugins similaires par place de marché
La même question posée à chaque place de marché séparément : y a-t-il là un équivalent de ce plugin ?
Référencé sur Claude Code: claude-plugins-community (5)
-
AI Agent Harness Engineering: bootstrap, audit, and evolve a reliable 6-layer agent harness for any project. Generates AGENTS.md, hooks (type-check, .env protection, auto-format…
-
The most comprehensive agentic coding harness for Claude Code that works for both greenfield and brownfield projects. Drops 38 slash commands, 36 sub-agents, and 16 skills into…
-
Prevents subagent tech debt by injecting project architectural context (module boundaries, CLAUDE.md rules, conventions) into every subagent's prompt. Validates code placement and…
-
Turn any task into production-ready code. Specialized agents automatically handle planning, implementation, code review, and security scanning for any stack.
-
A structured software development toolkit that helps Claude Code follow senior-engineer workflows. AI DevKit provides phase-based development lifecycle (requirements, design…
Référencé sur Claude Code: claude-plugins-official (5)
-
Comprehensive feature development workflow with specialized agents for codebase exploration, architecture design, and quality review
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Analyze codebases and recommend tailored Claude Code automations such as hooks, skills, MCP servers, and subagents.
-
Matt Pocock's agent skills for real engineering — grilling, spec/ticket flows, TDD, code review, domain modelling and more. Plug-and-play, not vibe coding.
Référencé sur Claude: knowledge-work-plugins (5)
-
Bring Qodo's codebase intelligence, coding standards, and code review into your coding agent.
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
AI-first project auditor and re-engineer based on the 9 design principles and 7 design patterns from the TechWolf AI-First Bootcamp
-
Streamline engineering workflows — standups, code review, architecture decisions, incident response, and technical documentation. Works with your existing tools or standalone.
-
Keep your coding agent up to date with the latest web best practices
Référencé sur Codex: openai-curated (openai/plugins) (5)
-
An agentic skills framework & software development methodology that works: planning, TDD, debugging, and collaboration workflows.
-
Evaluate Codex skills and plugins from chat with a beginner-friendly start command, local-first reports, token budget explanations, and guided benchmarking.
-
AI-powered code review in Codex, powered by CodeRabbit.
-
Inspect repositories, triage pull requests and issues, debug CI, and publish changes through a hybrid GitHub connector and CLI workflow.
-
Qodo setup, code intelligence, and review workflows.
Référencé sur Community GitHub marketplaces (5)
-
Endor Labs workflow agents and setup for Claude Code.
-
Comprehensive development workflow for building AI agents with the Atomic Agents framework. Includes specialized agents for schema design, architecture planning, code review, and…
-
Official Buildkite skills for Claude Code, Cursor, and other AI coding agents — pipelines, migration, preflight, agent runtime, CLI, and API
-
Sourcery security findings for AI coding agents: triage and minimal-change remediation via the public Sourcery API (12 MCP tools + skills).
-
Appwrite tools for Claude Code, including SDK skills, Appwrite MCP servers, and deployment commands.
Référencé sur Copilot CLI: github/awesome-copilot (5)
-
7 specialized agents covering the full software development lifecycle from UX design and architecture to security and DevOps.
-
Meta prompts that help you discover and generate curated GitHub Copilot agents, instructions, prompts, and skills.
-
Goal-driven task orchestration with independent verification. Interviews the user to define a clear goal, then loops between a Builder subagent (does the work) and an Inspector…
-
Analyze any repository and generate AI-ready configuration — AGENTS.md, copilot-instructions.md, CI workflows, issue templates, and more. Mines your PR review patterns and creates…
-
Build applications with the GitHub Copilot SDK across multiple programming languages. Includes comprehensive instructions for C#, Go, Node.js/TypeScript, and Python to help you…
Référencé sur Copilot CLI: github/copilot-plugins (5)
-
Bring Azure DevOps work-item, repository, and pull-request workflows into GitHub Copilot.
-
Advanced Security plugin for GitHub Copilot.
-
Toolkit for building Microsoft 365 Copilot declarative agents — scaffolding, JSON manifest development, and capability configuration.
-
code-apps-preview
Build and deploy Power Apps code apps using React, Vite, and Power Platform connectors.
-
Navigate and interact with your C++ code using the Microsoft C++ Language Server.
Référencé sur Cursor: cursor/plugins (5)
-
if you want to go fast, go deep first. pstack helps you write less, but higher quality code. rigorous agent workflows you can parallelize with confidence.
-
Patterns for designing CLIs that coding agents can run reliably: flags, help with examples, pipelines, errors, idempotency, dry-run.
-
Skills for building on the Cursor Origin API. Fetch the live spec first, then follow the Origin rules for credentials, scopes, webhooks, paging, and errors. Includes a skill that…
-
Build apps, scripts, and automations with the TypeScript SDK.
-
Internal team workflows for CI, code review, shipping, local automation, and verification.
Référencé sur Docker MCP Catalog (5)
-
Stop stitching context for Copilot and Cursor. With Sequa MCP, your AI tools know your entire codebase and docs out of the box.
-
Bridges multiple AI models and CLIs, enabling orchestrated workflows across Claude Code, Gemini CLI, Codex CLI, and other AI development tools.
-
Tools and resources for writing Effect code in Typescript.
-
Connect AI assistants to GitHub - manage repos, issues, PRs, and workflows through natural language.
-
Ref powerful search tool connets your coding tools with documentation context. It includes an up-to-date index of public documentation and it can ingest your private documentation…
Référencé sur Official MCP Registry (5)
-
patchwork — Codebase Conventions for AI Agents
Scan any codebase, generate CONVENTIONS.md, expose conventions as MCP tools for AI agents.
-
Analyzes codebases with tree-sitter and generates AGENTS.md files for AI coding agents.
-
Community of Consciousness MCP Server — upload and explore collective wisdom via GitHub.
-
agent-comm io.github.keshrath/agent-comm
Agent intercommunication - messaging, channels, shared state, and real-time events
-
Install the ContinueWith AI handoff widget from coding agents (Cursor, Claude Code, Codex).
Trouvés par le sens, et non par un code ou un dépôt commun : les plugins similaires restent des produits distincts, et ceci n'est ni un avis ni une recommandation.
C'est votre plugin ?
Prouvez que vous maintenez ce plugin avec un fichier dans son dépôt, un fichier sur votre domaine ou un enregistrement DNS. Vous recevez des alertes quand une place de marché le publie, le retire, change sa marque vérifiée ou ce qu'il demande, et vous pouvez mettre son endpoint distant sous surveillance comme service web.
Données issues de Claude Code: claude-plugins-community. Les chiffres proviennent de nos propres passages réguliers sur les places de marché, dernière lecture le . Nous ne publions aucune coordonnée des éditeurs de plugins.